KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_30610Help
Entry
STBHUCCB_30610    CDS       T01741                                 

Definition
exodeoxyribonuclease V subunit gamma
Orthology
K03583  
exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sex03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2982778..2986149)
Genome map
AA seq 1123 aa AA seqDB search
MLRVYHSNRLDVLEALMEFIVERERLDDPFEPEMILVQSTGMAQWLQMTLSQKFGIAANI
AFPLPASFIWEMFVRVLPDIPKESAFSKQSMSWKLMTLLPQLLDKDEFVLLRHYLTDDTD
KRKLFQLSARAADLFDQYLVYRPDWLTQWEAGKTVEGLGEAQNWQAPLWKALVEYTAALG
QPRWHRANLYQRFIQTLESATACPPGLPSRVFICGISALPPVYLKALQALGKHIEIHLLF
TNPCRYYWGDIKDPAWLAKLMARQRRHSFEDRHLPLFRENQNPEALFNSDGEQDIGNPLL
ASWGKLGRDYIYLLSELENSQELDAFVDITPDNLLHRIQADILELESHAVAGVNLEEYSR
SDNKRLLDPEDNSLSFHVCHSPQREVEILHDRLLAMLEADPTLTPRDIIVMVADIDSYSP
FIQAVFGSAPTERYLPYAISDRRARQSHPVLQAFISLLSLPDSRFVSEDVLALLDVPVLA
ARFTINEEGLRYLRLWVNESGIRWGIDDDNVRELELPATGQHTWQFGLTRMLLGYAMESA
QGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWRRGLAQERPLEEWLPVCRDMLNDFFL
PDADTEAAMTLIEQQWQAIIAEGVAAEYGDAVPISLLRDELAQRLDQERISQRFLAGPIN
ICTLMPMRSIPFRVVCLLGMNDGVYPRQLAPLGFDLMSQKPMRGDRSRRDDDRYLFLEAL
ISAQQTLYISYIGRSIQDNSERFPSVLVQELVDYIGQSHYLPGDETLTCDESEARVKAHI
TRLHTRMPFDAQNYQPGEQQSYAREWLPAASQSGKAHSDFVQPLPFTMPETLTLESLQRF
WAHPVRAFFQMRLQVNFRSEESEIPDAEPFELEGLTRYQLNQQLLNTLVEEDDAERLFRR
FRAAGELPYGAFGEIFWDAQCQEMQQLASRVIACRKPSQSLEVDLLCNGVQLTGWLPQVQ
EDGLLRWRPALISVAQGVQLWLEHLVYCASGGSGESRLFLRKEGEWRFPPLDKTQAMAYL
AQLIEGYREGMSSPLLVLPESGGAWIKACYDAENDVMLDDDDTLQKARTKFLQAYEGNMM
VSGEGEDIWYQRLWRQLESETLQAIIAQSRHYLLPLFRFNQSR
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgttaagggtctaccactccaatcgtctggatgtgctggaagcgttgatggagttcatc
gtcgaacgcgagcggctggatgatccctttgaaccagaaatgattctggtacaaagcacg
ggtatggcgcagtggctgcagatgaccctttcacaaaagtttggtattgcggcgaatatc
gcttttccgttaccggcgagttttatctgggagatgtttgtccgcgtgttgccagatatc
cccaaagaaagcgctttcagcaaacaaagcatgagctggaaactgatgaccttgctgccg
cagttgctggataaggatgagtttgtactgctgcgccattatctgaccgacgacaccgat
aaacgcaaactctttcagctttccgcgcgcgccgccgacctgttcgatcagtatctggtt
tatcggcctgactggcttacgcagtgggaggcgggaaaaaccgtggaaggtctgggagag
gcgcaaaactggcaggcgccgctgtggaaagcattggtggaatataccgccgcgctgggg
cagccgcgctggcatcgcgccaatctctaccaacgctttattcaaacgctggaaagcgcg
accgcctgcccgccagggttgccgtcccgcgtttttatttgcggcatttccgcgttaccg
ccagtgtatctcaaagcattgcaggcgctgggtaaacatattgaaatccatctccttttt
actaatccgtgtcggtattactggggggatataaaagacccagcctggctggcaaaactc
atggctcgccagcgtcgtcacagttttgaagaccgtcatttaccgttgttccgtgaaaat
cagaatccggaagccttatttaacagcgacggtgaacaggatatcggtaatccgctactg
gcctcatggggaaaactgggacgggattatatctacctgctatctgaactggaaaacagc
caggagctggatgcgtttgttgatattacgccagataatcttttgcatcggattcaggcg
gatatccttgaactggaaagccatgcggtggcgggcgtaaatcttgaggagtattcgcgc
agcgacaataagcgtctgctcgatcccgaggataacagcctctcttttcacgtttgtcac
agcccgcagcgcgaggtggaaatactgcacgatcgcctgctggcgatgctggaagccgat
ccgacgctaacgccgcgcgacattatcgttatggtggctgatattgacagctatagcccg
tttatccaggcggtatttggtagcgcgccaacggagcgctatctgccttatgctatttcc
gatcggcgggcgcgtcagtcacatccggtgttacaggcatttatcagtctgctttcgtta
ccggacagccgcttcgtctccgaggatgttctggcgttgttagacgtaccggtattggct
gcccgctttacgatcaacgaagaagggctgcgttatttgcgcttgtgggtcaatgagtca
ggcattcgctgggggattgacgatgacaacgtgcgcgagctggaacttcctgccacgggg
cagcatacatggcaatttggcctgacgcgtatgctgctggggtatgcgatggaaagcgcc
cagggcgagtggcagtcggttctgccttatgacgaatccagcggtctgattgctgagctg
gtcgggcatctggcttcgctgctgatgcagcttaatatctggcggcgcggtctggcgcag
gagcgacctctggaagagtggttgcccgtttgtcgcgacatgctcaatgatttcttcctg
cccgatgcggacacggaagcggcaatgacattgattgaacagcagtggcaggccattatc
gccgaaggcgtcgcggcggaatatggcgacgcggtaccgatttcgctactgcgggatgag
ctggcgcagcgtctggatcaggaacgtattagccagcgcttcctggcgggccccatcaat
atttgtacgctgatgccgatgcgttccattccgttcagagtcgtttgcctgctgggaatg
aacgacggcgtatacccgcgccagcttgcgccgttgggctttgacctgatgagccaaaaa
cccatgcgcggggatcgtagccgtcgcgacgatgaccgctacctgtttctggaagcgtta
atctcggcgcagcagacgctgtatatcagctacatcggtcgctccatccaggataatagc
gaacgctttccctctgtactggtgcaagaattggtggattacatcgggcaaagccactat
ttgccgggcgacgaaacgctgacctgtgatgagagcgaagcacgagtcaaagcgcatatt
acgcgtctgcatacccgtatgccttttgatgcgcaaaattaccaacccggcgaacagcaa
agttatgccagagagtggttgcccgcggcgagtcagtcgggaaaagcgcattctgacttt
gtgcagccgcttccttttacgatgccggaaacattgactctggaaagtctgcagcgtttt
tgggcccatccggtacgcgcattttttcagatgcggcttcaggttaatttccgctcggaa
gagagtgagattcctgatgctgaaccgtttgaattagagggattgacgcgatatcaactt
aaccaacagttgctcaatacgttggttgaagaggacgatgccgaacgcttgttccgccgt
tttcgggctgcgggagagctgccttacggcgcgtttggcgaaatattctgggatgcgcag
tgtcaggagatgcagcaactggcaagccgggttatcgcttgccgtaagccgagccaaagc
ctggaagtggatctgctttgcaatggagttcagctaaccggctggctaccgcaggtacag
gaggatggattattgcgctggcgtcccgctttaatcagcgtggcgcaaggtgtgcaactt
tggctggaacaccttgtctattgtgccagcggcggtagtggcgaaagtcgcctgtttttg
cgcaaagagggagaatggcgatttccgcctcttgataaaacgcaggcaatggcttacctg
gcgcaactgattgaaggctaccgggaaggcatgtcttctccgctattggtactgccggaa
agcggcggcgcatggataaaagcctgttatgacgctgaaaatgatgtcatgttagacgac
gatgatactttacagaaggccaggacaaagtttctacaggcttatgaaggcaacatgatg
gtgagcggcgaaggcgaagatatctggtatcaacgtctttggcgtcagctggaatcggaa
acgttgcaggctatcattgcgcagtcacggcattacctgttaccgctgtttcgttttaat
cagtctcgttga

DBGET integrated database retrieval system