KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_32930Help
Entry
STBHUCCB_32930    CDS       T01741                                 

Definition
3,4-dihydroxy-2-butanone 4-phosphate synthase
Orthology
K02858  
3,4-dihydroxy 2-butanone 4-phosphate synthase [EC:4.1.99.12]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    STBHUCCB_32930
Enzymes [BR:sex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     STBHUCCB_32930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(3189489..3190142)
Genome map
AA seq 217 aa AA seqDB search
MNQTLLSSFGTPFERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIR
HGSGIVCLCITEDRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRA
AIKDGAKPSDLNRPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDG
TMARAPECIAFAGQHNMAVVTIEDLVAYRQAHERKAS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagacgctactttcctcttttggtacgccttttgaacgtgttgaacttgcactg
gatgcgctgcgtgaaggacgcggtgtgatggtgcttgatgatgaagatcgtgaaaacgaa
ggcgatatgattttccccgcagagacaatgaccgtagaacagatggcgttaaccattcgt
cacggtagcggtattgtttgcctgtgtattactgaagatcgccgtaagcagctcgatttg
ccaatgatggtggaaaacaacaccagcgcctacggcaccggttttaccgtgaccattgaa
gccgcagaaggcgtgaccaccggcgtttccgccgctgaccgtgtcactacggtgcgtgcg
gcaattaaggatggcgcaaaaccgtccgatcttaaccgtccggggcacgttttcccactg
cgcgctcaggcgggcggcgtgctgacgcgcggcggtcatacggaggcgaccatcgatctg
atgacgctggccggttttaaacctgcaggtgtactgtgcgagttgactaacgacgatggg
acgatggcgcgcgcgccggagtgtatcgcgtttgcaggccagcataatatggcggtggtc
acgattgaagatctggtggcttaccgccaggcgcatgagcgcaaagccagctga

DBGET integrated database retrieval system