KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_33630Help
Entry
STBHUCCB_33630    CDS       T01741                                 

Definition
Galactitol-specific phosphotransferase enzyme IIB component
Orthology
K02774  
PTS system, galactitol-specific IIB component [EC:2.7.1.69]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Galactose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, galactitol-specific II component
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sex00052]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:sex02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3259903..3260187
Genome map
AA seq 94 aa AA seqDB search
MKRKVIVACGGAVATSTMAAEEIKELCDANHIELDLVQCRVTEIETYMDGADLICTTARV
DRAFGDIPVVHGMPFVSGVGIEALQQKILSILMG
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaaagtaattgtggcctgtggcggtgcggttgcaacctcaacgatggctgcg
gaagaaattaaagagctatgtgatgccaaccatattgagctcgacttagtgcaatgccgg
gtcaccgaaatcgaaacctatatggacggcgccgatcttatctgtaccactgccagggtc
gatcgcgcctttggcgatattcccgtcgttcacggtatgccttttgtttccggcgtgggt
attgaagcattacagcaaaaaattctgtccattctcatggggtaa

DBGET integrated database retrieval system