KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_33630Help
Entry
STBHUCCB_33630    CDS       T01741                                 

Definition
Galactitol-specific phosphotransferase enzyme IIB component
Orthology
K02774  
PTS system, galactitol-specific IIB component [EC:2.7.1.69]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Galactose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, galactitol-specific II component
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    STBHUCCB_33630
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    STBHUCCB_33630
Enzymes [BR:sex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     STBHUCCB_33630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3259903..3260187
Genome map
AA seq 94 aa AA seqDB search
MKRKVIVACGGAVATSTMAAEEIKELCDANHIELDLVQCRVTEIETYMDGADLICTTARV
DRAFGDIPVVHGMPFVSGVGIEALQQKILSILMG
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaaagtaattgtggcctgtggcggtgcggttgcaacctcaacgatggctgcg
gaagaaattaaagagctatgtgatgccaaccatattgagctcgacttagtgcaatgccgg
gtcaccgaaatcgaaacctatatggacggcgccgatcttatctgtaccactgccagggtc
gatcgcgcctttggcgatattcccgtcgttcacggtatgccttttgtttccggcgtgggt
attgaagcattacagcaaaaaattctgtccattctcatggggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system