KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_35290Help
Entry
STBHUCCB_35290    CDS       T01741                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    STBHUCCB_35290
   00565 Ether lipid metabolism
    STBHUCCB_35290
   00590 Arachidonic acid metabolism
    STBHUCCB_35290
   00591 Linoleic acid metabolism
    STBHUCCB_35290
   00592 alpha-Linolenic acid metabolism
    STBHUCCB_35290
Enzymes [BR:sex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     STBHUCCB_35290
    3.1.1.32  phospholipase A1
     STBHUCCB_35290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3431296..3432165)
Genome map
AA seq 289 aa AA seqDB search
MRAILRGLLPATLLPLAAYAQEATIKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGYHLGEAVLSAKGQYNWNTGY
GGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDIF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgattttgagagggttgttgccagccacgctactgccattagcggcatatgca
caagaagctacgataaaagaggttcatgatgcgcctgcagtacggggaagtatcatcgct
aacatgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttg
atctacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaa
aacgcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcgga
atactggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctt
tccaacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttctt
ggttttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctac
aaccatgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacc
cgtctgatggccgaaaacggtaactggctggtagaggtcaaaccatggtacgtgattggc
agtaccgacgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggt
tatcacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctac
ggcggcgcggaagttggattaagctatccggtcactaaacatgtccggctttatacccag
gtgtatagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggc
gtcggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system