KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_36060Help
Entry
STBHUCCB_36060    CDS       T01741                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Brite
Enzymes [BR:sex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     STBHUCCB_36060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3507694..3508206
Genome map
AA seq 170 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERALERCVKQQPPQKVYDAAVSFAFNVGTGNAC
SSTLVKLLNQRRWADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLQGAN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcggggccgtgctggctattgctgccacg
ctgccgggttttcagcagcttcacacctccgtggaggggctgaaactgattgccgattac
gaaggttgtcgtctgcagccgtatcagtgcagcgcgggtgtctggaccgacggcattggt
aatacgtcaggcgtcattcccggcaaaaccattacggagcgacaggcagcagaagggctg
atctccaacgtgctgcgtgtggagcgggcgctggaaaggtgtgtgaagcaacagccgccg
cagaaggtgtatgacgctgcggtgtcgtttgccttcaacgtgggaacgggcaatgcctgc
agttccacactggtgaaattactcaatcagcggcgctgggcggatgcgtgccgacagttg
ccgcgctgggtttatgtgaaaggtgtttttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgcttacagggagcaaactga

DBGET integrated database retrieval system