KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_37140Help
Entry
STBHUCCB_37140    CDS       T01741                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    STBHUCCB_37140
Enzymes [BR:sex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     STBHUCCB_37140
Exosome [BR:sex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STBHUCCB_37140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3624041..3625546
Genome map
AA seq 501 aa AA seqDB search
MTEKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSSTL
VEVLAKADISSDQIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTANICEQLKRDGL
EDYIRDNTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVHV
TDYTNASRTMLFNIHDLDWDDKMLDVLDIPRAMLPQVRKSSEVYGQTNIGGKGGTRIPIA
GIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPSGEVNY
ALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPYA
RGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLMQ
FQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETTERN
YRYSGWKKAVKRAMAWEEHDK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaatatatcgttgcgctcgaccagggtaccaccagctcccgcgcggtcgtt
atggatcatgacgcgaatatcgtcagcgtatcacagcgtgaatttgagcaaatttatcct
aagccaggctgggtagaacacgacccgatggaaatttgggcgtctcaaagctcaacgctg
gtagaagtgctggctaaggccgatatcagttccgatcagattgccgctatcggtatcacc
aaccaacgtgaaaccgcgatcgtctgggaacgtgaaaccggcaaaccgatatacaacgct
attgtctggcagtgccgtcgtaccgccaatatttgcgaacagcttaaacgcgacggcctg
gaagattacatccgcgacaataccggtctggtcgtcgacccgtacttctctggcactaaa
gtgaaatggatccttgaccatgtggaaggttcgcgcgaacgcgcgaagcgtggcgagctg
ctgttcggtacggtggatacctggcttatctggaagatgacgcagggccgcgtccacgtt
acggattacaccaacgcctcacgaaccatgctgttcaacatccatgatttggactgggac
gataaaatgctggacgtgctggatatcccacgcgcgatgctgccccaggtacgtaaatcc
tccgaagtctacggccagaccaatattggcggtaaaggcggtacacgtattcctatcgcc
gggattgccggggatcagcaggccgcgctcttcggccaactgtgcgtaaaggaaggaatg
gcaaagaacacctacggcaccggctgctttatgctgatgaacaccggcgagaaagcggta
aaatcggaaaacggcctgctgaccaccatcgcctgcggcccaagcggcgaagtcaactat
gcgctggaaggtgcggtgtttatggcgggagcgtccattcaatggctgcgtgatgaaatg
aagctcatcagcgacgcattcgactccgaatatttcgccacgaaagtgaaagataccaac
ggtgtctacgtggttccggccttcaccggtctgggcgcgccgtactgggatccgtatgcc
cgcggcgccatttttggcctgacccgcggcgtgaactctaatcacattatccgcgcgacg
ctcgaatccatcgcttaccagacccgcgacgtactggaagcgatgcaggccgactccggt
atccgcctgcacgctctgcgtgtggacggcggcgcagtggccaacaacttcctgatgcag
ttccagtcagatattctcggcacgcgggtggaacgcccggaagtgcgcgaagtgaccgcg
ctgggcgccgcctatctggctggcctggccgtcggttactggcagaacctggacgagctg
caggaaaaagccgtcattgagcgagaattccgccccggcattgaaaccaccgagcgtaac
taccgttacagcggctggaagaaagcggttaaacgcgcaatggcgtgggaagagcacgac
aagtaa

DBGET integrated database retrieval system