KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_4110Help
Entry
STBHUCCB_4110     CDS       T01741                                 

Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00300  Lysine biosynthesis
sex01100  Metabolic pathways
sex01120  Microbial metabolism in diverse environments
sex01230  Biosynthesis of amino acids
Module
sex_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STBHUCCB_4110
Enzymes [BR:sex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     STBHUCCB_4110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AEZ44153
Position
complement(445724..446851)
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDVGCQALMIERLRKIGFTIEHMDFGDTQNFWAWRGRGET
LAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacagcaacttattcgtcgcccctccctgagtccg
gatgacgtaggctgtcaggcattaatgattgaacgcctgcgtaaaatcggttttaccatt
gagcatatggattttggcgacacgcaaaatttttgggcatggcgtgggcgtggcgaaacg
ctggcgttcgccgggcatactgacgtcgtaccggctggcgatgtcgatcgctggatcaat
ccgccgtttgaacctacgattcgcgacggaatgttgttcggtcgcggcgcggcggatatg
aaaggttcactggcggccatggtggtggctgctgaacgttttgttgcacagcatcctcat
caccggggccgcctcgcatttttgattacctctgatgaagaagccagcgcaaaaaatggc
accgtaaaggtggttgaagcgctgatggcccgtaacgagcggctggattactgtctggtc
ggcgaaccttccagtactgaaattgtgggcgatgtcgtcaaaaacgggcgtcgcggttcc
ctcacctgtaacctcactattcatggcgttcaggggcacgttgcctatccgcatctggcg
gataaccctgttcatcgcgccgcgccttttctcaatgaactggtcgctatcgagtgggat
cggggcaatgactttttcccggccaccagtatgcagatagccaatatccaggcaggcacc
ggcagcaataatgtcattcccggcgaactgttcgtgcagtttaacttccgttttagcacg
gagctgaccgatgagatgatcaaagaacgggtacatgcgctgcttgagaagcatcagcta
cgctataccgtagactggtggctttccggtcagccgttcctgaccgcacgcggaaagctg
gtggacgcggtggtaaacgccattgagcactataatgaaattaaaccgcaattactgacg
acgggcggtacgtccgacggacgttttatcgcccgtatgggagcgcaggtggtagaactg
gggccggtgaacgccaccattcataaaattaacgaatgtgtgaatgccgccgatctccag
ctactggcccgtatgtatcaacgtattatggaacagctcgtcgcctga

DBGET integrated database retrieval system