KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_42250Help
Entry
STBHUCCB_42250    CDS       T01741                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sex00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4129843..4131924
Genome map
AA seq 693 aa AA seqDB search
MENKRLDSAALAAGISPSYINAHGKPQSIGAETKRRLLAAMHGTTTGPQAVVPNVKVYTA
GKKMALPVEGRGEFAWLLTTEEGEHYKGRVTGGKKLNLPATLPEGYHTLTLTQDEQRTHC
RIIVAPPRCYEPQALLEGKKLWGACVQLYTLRSEKNWGIGDFGDLKSMLVDVATRGGAFI
GLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRLSEEAQAWWQMPATQQKLR
QARDAQWVDYATVTALKITALRMAWTRFAARDDAQMAEFRHFIAREGESLYWQAAFDALH
AYQVKEDGQRWGWPAWPEAYQSVESPAVKQFCEAHREEVEFYLWLQWLAWRQFAACWDTC
QSFKLPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPHI
IVARAYEPFIDLLRANMQNCGALRIDHVMSLLRLWWIPYDETADQGAYVHYPVDDLLSIL
ALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLWFENDLEKNFRAPGAYPQQSMA
VASTHDLPTLRGYWECGDLTLGKALGLYPDEVILRGLYEDRERAKQGLLDALHKYGCLPK
RAGHKALLMSMTPTLNRGLQRYIADSNSGLLGLQPEDWLDMADPVNVPGTSDQYKNWRRK
LSASLEAMFADEGVNKLIKDLDKRRKAAAKKKK
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaacgtctcgatagtgccgcgctggcggcggggatcagccccagttacatc
aatgctcatggcaaaccgcagtctattggcgctgaaaccaagagacgtttgctggcggcg
atgcacggcacgacaacaggaccacaggcggtcgtgccgaatgtgaaggtttataccgcg
ggtaaaaaaatggcgttgccggtagaggggcgcggtgagtttgcctggctgctgactacg
gaagagggcgagcattacaaagggcgcgtgacgggcggtaaaaaacttaacctgccggct
acgttgccggagggctaccacaccctgacgttgacccaggatgaacagcgtacgcactgc
cgtattatcgttgccccgccgcgatgctatgagccgcaggcgctgctggaggggaaaaaa
ctgtggggggcctgcgtccagctttatactctgcgttcagaaaaaaactggggtattggc
gatttcggcgatttgaagtcgatgctggtcgacgtggcgacacgcggcggcgcgtttatc
ggcctgaacccgatccacgcgctttatccggcgaatccggagagcgccagtccctacagc
ccctcgtctcgtcgctggctgaacgtgatatatatcgacgtcaacgccgtcgaagatttc
cgcctgagcgaagaggcgcaggcatggtggcaaatgcccgccacacagcaaaagctgcga
caggcgcgcgatgcgcaatgggtggattacgctaccgttaccgcgctgaaaatcacggcg
ctgcggatggcgtggacgcggtttgccgctcgcgacgatgcgcaaatggcggagtttcgt
cactttatcgcccgcgaaggcgaaagcctttactggcaggcggcattcgacgcgctgcat
gcgtatcaggtgaaagaggatgggcagcgctggggctggccagcctggccggaggcgtac
cagtcggtagagtctcccgctgtaaaacaattctgtgaagcgcaccgcgaagaggtggag
ttttatctctggcttcagtggctggcctggcgccaattcgccgcctgctgggatacctgc
cagagttttaaactaccgattggtctgtaccgcgatctggcggttggcgtagcggaaggc
ggcgcggaaacctggtgcgaccgggagctgtactgcctgaaagcatctgtcggcgcgccg
ccggatatcctcggcccgctcggtcagaactgggggctgccgccgatggacccgcatatc
attgtcgcccgggcgtatgagccctttatcgacctgctgcgcgccaatatgcaaaactgc
ggcgcgttgcgcattgaccatgtcatgtcgttgctgcgcctgtggtggataccgtatgac
gaaacagcggatcagggggcttacgtccattatccggtagatgatttgctttctattctg
gcgctggagagccaacgtcaccgctgtatggtgataggcgaagatctggggacggtgcca
gttgagattgtcggcaagctgcgcgatagcggggtctattcttataaagtgctgtggttt
gaaaatgaccttgagaaaaacttccgcgcgccaggcgcatatccgcaacaatcgatggct
gtcgcctcgacgcacgatctccccacgctgcgcggctattgggaatgcggtgacctgacg
ttgggtaaagctctggggctttatccggatgaagtgattctgcgcgggctgtatgaggat
cgcgagcgggcgaaacaggggctattggacgcgctgcataaatatggctgtctgccaaaa
cgcgccgggcataaggcattgttaatgtcgatgacgccaacgctaaatcgcggacttcag
cgctatatcgccgacagtaacagcggtctgttggggcttcagccggaggactggctggat
atggccgatccggttaacgtaccgggcaccagcgatcagtataaaaactggcggcggaaa
ttgtctgcatctcttgaggctatgtttgccgatgagggcgtaaacaagctgattaaggat
ttggataagcgccgaaaagcggccgcgaagaagaagaagtaa

DBGET integrated database retrieval system