KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_43490Help
Entry
STBHUCCB_43490    CDS       T01741                                 

Definition
Gex interacting protein 7
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STBHUCCB_43490
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STBHUCCB_43490
Enzymes [BR:sex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     STBHUCCB_43490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4239543..4240847
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGE
AKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVVADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWASGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDPYDSGFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtactcaacaaatcgaagaattacagaaagagtggacacaaccgcgctgg
gaaggcatcacccgcccgtacagcgcggaggaggtggtgaaattacgcggctcggttaac
ccggaatgcacgctggcgcagctcggcgccgcgaaaatgtggcggctgttgcacggtgaa
gcgaaaaaaggctatatcaacagcctgggcgcgctgactggcggtcaggcgctgcagcag
gcgaaagccggtattgaggcgatttatctttcaggctggcaggtggtggcagatgccaac
ctggcatccagcatgtatccggatcaatcgttgtacccggcaaactctgttccggcggta
gtggatcggatcaacaacactttccgtcgtgcagatcagatccagtgggcatccggtatt
gaacccaacgatccgcgctatgtggattacttcctgccgatcgttgctgatgcggaagcc
ggttttggcggcgttctgaatgccttcgaactgatgaaatcgatgattgaagccggtgca
gcggccgttcacttcgaagatcagctggcgtcggtgaagaaatgcggccatatgggcggc
aaggtgctggtccccacgcaggaggcgattcagaaactggttgctgcgcgtctggccgct
gatgtgatgggcgtcccgacgctggtgattgcgcgtaccgatgcggatgcggcagatctg
atcacctccgactgcgatccctatgacagcggttttattaccggcgaacgcaccagcgaa
ggtttttaccgcacccatgcgggcattgagcaggcgatcagccgcggtctggcgtatgcc
ccgtatgccgatctggtatggtgcgaaacttctacgccggatctcgaactggcgcgtcgt
tttgccgatgctatccacgcgaagtatccgggcaaactgctggcctataactgttcgcca
tccttcaactggcagaagaatctggacgacaagaccattgccagcttccagcagcagttg
tcggacatgggttacaaataccagtttattaccctggcgggcatccacagcatgtggttc
aacatgttcgacctggcgcatgcatacgctcagggtgagggcatgaaacactatgttgag
aaggttcaacaacccgagttcgccgcagcgaaagacggttacacctttgtttcccaccag
caggaagtgggtactggttacttcgacaaagtcaccaccattattcagggcggcgcgtca
tccgttaccgcgttaacgggttccaccgaagaatcgcagttttga

DBGET integrated database retrieval system