KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_44470Help
Entry
STBHUCCB_44470    CDS       T01741                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    STBHUCCB_44470
  Lipid metabolism
   00561 Glycerolipid metabolism
    STBHUCCB_44470
   00600 Sphingolipid metabolism
    STBHUCCB_44470
Enzymes [BR:sex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     STBHUCCB_44470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4359389..4360744
Genome map
AA seq 451 aa AA seqDB search
MMTAPKITFIGAGSTIFVKNILGDVFHREALKSAHVALMDIDETRLEESHIVVRKLMDSA
GASGRITCHTHQKAALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGI
MRALRTIPHLWQICEDMTEVCPKATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTA
EELARDLNIDPASLRYRCVGINHMAFYLELERKTADGTYVNLYPELLAAYDAGQAPKPNI
HGNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIARYKVPLDEYPKRCV
EQLANWHKELEEYKTAERIDIKPSREYASTIMNALWTGEPSVIYGNVRNEGLIDNLPQGS
CVEVACLVDANGIQPTKVGTIPSHLAAMMQTNINVQTLLTEAILTENRDRVYHAAMMDPH
TAAVLGIEEIYALVDDLIAAHGDWLPAWLRR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggcacccaaaattacctttatcggcgcaggttctacgattttcgtcaaaaat
atcctcggcgatgtgtttcaccgcgaggcgctaaagtcagcgcatgtcgccctgatggat
attgacgaaacccggctggaagagtcgcacattgtggtacggaaactgatggactcagcg
ggcgcttctggccggattacctgccatacccaccagaaagcggcgctacaggatgcggat
ttcgtggtggtcgcctttcagattggcggctatgaaccctgcaccgtgaccgattttgag
gtttgtaagcgtcatggcctggaacagacgatcgccgatacgctggggccgggcggcatc
atgcgcgcgctgcgaaccatcccgcatctgtggcagatttgcgaagacatgacggaagtc
tgtccgaaggccaccatgctcaattacgtcaacccgatggcgatgaatacctgggcgatg
tatgcccgctatccgcatatcaaacaggtcggcctgtgccattcggtacagggaacggcg
gaagaactggcgcgcgacttgaatatcgatcccgcctcgctgcgctaccgctgcgtcggc
attaaccacatggcgttttacctggaactggagcgcaaaacggctgacgggacttatgtc
aatctctatcctgaattgctggcggcttatgacgccggacaggcgccgaagcccaatatt
cacggcaatgaacgctgccagaacatcgtgcgctatgagatgttcaaaaagttgggctac
ttcgtcacggagtcatcagagcattttgccgagtacacgccgtggtttattaaaccggga
cgcgaggatctgattgcgcgctacaaggtgccgctggatgaatatccgaaacgctgcgta
gaacaactggcgaactggcataaagagctggaggagtataaaaccgccgagcgtatcgac
atcaaaccgtcccgcgagtacgccagcaccattatgaacgctctgtggaccggcgagccg
agcgtgatttacggcaatgtgcgtaatgagggactgattgataacctgccgcagggaagc
tgcgtcgaggtggcttgtctggtagatgccaacggcattcaaccgacgaaggtggggacg
atcccttcccatctggcggcaatgatgcagaccaacatcaacgtgcaaacgctgttgacc
gaagccatcctcacggaaaaccgcgatcgcgtgtatcacgcggcgatgatggaccctcat
accgcggcggtgctgggtatcgaagaaatctatgcgttggttgacgatctgatcgccgcg
catggcgactggcttccggcctggttacgccgttaa

DBGET integrated database retrieval system