KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_47080Help
Entry
STBHUCCB_47080    CDS       T01741                                 

Definition
3'(2'),5'-bisphosphate nucleotidase cysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    STBHUCCB_47080
Enzymes [BR:sex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     STBHUCCB_47080
Transfer RNA biogenesis [BR:sex03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    STBHUCCB_47080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4591200..4591865
Genome map
AA seq 221 aa AA seqDB search
MEYARKQDDSPVTAADIAAHTVILEGLRTLTPDIPVLSEEDPPAWEVRQHWQRYWLVDPL
DGTKEFIKRNGEFTVNIALIEQGKPVLGVVYAPVLKVMYYAAEGKAWKEECGVRKQIQVR
DARPPLVVISRSHTDDELTEYLQQLGEHQTTSIGSSLKFCLVAEGQAQLYPRFGPTSVWD
TAAGHAIAVAAGAHVHDWQGKTLDYTPRESFLNPGFRVTIY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgcccgcaagcaggacgattctccagtcactgcggcggatatcgccgcacat
accgtgattctcgaagggttacgcacgctcacgccggatattccggtgctttcagaagaa
gatccgcccgcctgggaagtgcgccagcactggcagcgttactggctggtcgatccgctc
gacggcaccaaagaattcatcaagcgcaatggagaattcacggtcaatatcgcgctgatt
gagcagggcaagccggtgttgggcgttgtctatgcgccggtgctgaaagtgatgtactac
gcggcggaaggtaaggcctggaaagaggagtgcggggtgcgtaagcagattcaggtgcgg
gatgcccgcccgccgctggtggtgattagccgttcgcatacggatgatgaactcaccgaa
tatctccaacagcttggcgaacatcagactacctctattggttcctcgctgaaattctgt
cttgtggcggaaggacaggcgcagctttaccccagatttgggccgaccagcgtctgggat
actgccgcaggtcatgccattgccgttgcagccggggcgcacgttcacgactggcaggga
aaaacgctggactatacccctcgtgaatcgttccttaaccccggcttccgggtgactatt
tactga

DBGET integrated database retrieval system