KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_47670Help
Entry
STBHUCCB_47670    CDS       T01741                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STBHUCCB_47670
   00240 Pyrimidine metabolism
    STBHUCCB_47670
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    STBHUCCB_47670
   03430 Mismatch repair
    STBHUCCB_47670
   03440 Homologous recombination
    STBHUCCB_47670
Enzymes [BR:sex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STBHUCCB_47670
DNA replication proteins [BR:sex03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STBHUCCB_47670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4646925..4647368)
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTVNGLSAVEQLVCEIAAERWRAGKRVLIACEDEKQAIRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTSFADFATAFTEVVDFVPYE
ETLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgcgacgttctatcttctggacaatgacaccaccgtcaacggtttaagcgcc
gttgaacaactggtgtgtgaaattgccgcagaacgttggcgcgctggcaagcgcgtgctg
atcgcctgcgaagatgagaagcaggccattcggctggatgaagcgctgtgggcaagaccg
gcggaaagttttgtcccgcacaatctggcaggcgaaggcccacgcggcggcgcgccggtt
gaaatcgcctggccgcaaaaacgcaacagcagcccgcgcgatattttaatcagcctgcgt
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgtcccttacgaa
gaaactttgaaacaactggcgcgcgaacgctacaaagcctaccgcgtggctggttttaac
ctgaatacggcaacctggaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system