KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_4870Help
Entry
STBHUCCB_4870     CDS       T01741                                 

Definition
(GenBank) Glk
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00010  Glycolysis / Gluconeogenesis
sex00052  Galactose metabolism
sex00500  Starch and sucrose metabolism
sex00520  Amino sugar and nucleotide sugar metabolism
sex00521  Streptomycin biosynthesis
sex01100  Metabolic pathways
sex01110  Biosynthesis of secondary metabolites
sex01120  Microbial metabolism in diverse environments
sex01130  Biosynthesis of antibiotics
sex01200  Carbon metabolism
Module
sex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sex_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STBHUCCB_4870
   00052 Galactose metabolism
    STBHUCCB_4870
   00500 Starch and sucrose metabolism
    STBHUCCB_4870
   00520 Amino sugar and nucleotide sugar metabolism
    STBHUCCB_4870
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STBHUCCB_4870
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    STBHUCCB_4870
Enzymes [BR:sex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     STBHUCCB_4870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AEZ44229
Position
525127..526092
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHGVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADSCIDCRRALSLFCVI
MGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattaccccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatggcgtcagcgtggaagatggttgt
atcgccatagcctgcccgattaccggcgactgggtggcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagtcatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtacggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggaaaatctgcgcccgaaagatattaccgaa
cgcgccctggcggatagctgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatttggcggcgtttatatc
gctggcggcattgtcccgcgcttcctggaattctttaaagcgtctggcttccgtgggggc
tttgaagataaaggccgctttaaagattatgtacacggtattccggtctatctgattgtc
catgataatcccggcttgttaggctccggcgcgcatctgcgccagacattaggccatatt
ctataa

DBGET integrated database retrieval system