KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_8300Help
Entry
STBHUCCB_8300     CDS       T01741                                 

Definition
DTDP-6-deoxy-D-glucose-3,5 epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    STBHUCCB_8300
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STBHUCCB_8300
Enzymes [BR:sex01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     STBHUCCB_8300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
870227..870775
Genome map
AA seq 182 aa AA seqDB search
MIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKSKKNVLRG
LHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHG
FVTLSDYAEFLYKATNYYSPSSEGSILWNDETIGIEWPFSQLPELSAKDAAAPLLHQALL
TE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgattaaaacagcaataccagatgtcttgatcttagagcctaaagtttttggc
gatgagaggggattcttttttgaaagttataaccagcagacctttgaagagtcgattgga
cgtaaagttacatttgttcaagataatcattcaaaatccaaaaagaatgtactcagaggg
ctacattttcagagaggagaaaatgcacagggaaagttagttcgctgtgctgtcggtgag
gtttttgatgttgcggtcgatatccgaaaagaatcacctacttttggtcagtgggttggc
gtaaatctatctgctgagaataagcgacagctttggattccagaaggttttgctcatggt
tttgttactctcagtgattatgcagagtttctgtacaaagcaactaattattactcacct
tcatcggaaggtagcattctatggaatgatgagacaataggtattgaatggcctttttct
cagctgcctgagctttcagcaaaagatgctgcagcacctttactgcatcaagccttgtta
acagagtaa

DBGET integrated database retrieval system