KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_9940Help
Entry
STBHUCCB_9940     CDS       T01741                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    STBHUCCB_9940
Enzymes [BR:sex01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     STBHUCCB_9940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1016851..1017837
Genome map
AA seq 328 aa AA seqDB search
MPLHHLTRFPRLELIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIVQQC
EEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAG
QLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLANLEGVLLDPVYTGKAMAGLIDGIS
QKRFNDDGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactacatcacttaacgcgctttcctcgcctggagcttattggcgcgccgaccccg
ctcgaatacctgccgcgattgtctgattatcttggccgtgagatttacattaagcgcgat
gacgttacgcccattgcaatgggcggcaataaactgcgtaagctggagtttctagtggcc
gacgcgctgcgagaaggggcggatacgctgataaccgcaggggcgattcagtcaaaccat
gtccgtcagacggcggcggttgcggccaaattggggctgcattgcgtcgccttgctggaa
aatccaatcggtaccaccgcggaaaattacctgacgaatggtaatcgcctgttactggat
ttatttaatacacaaattgagatgtgcgatgcgctaaccgatccggatgcgcagctgcaa
acgctggcgacgcgcattgaagcgcaagggttcaggccctatgtgattccggtcggcggc
tccagcgcgttgggcgcaatgggatacgtagagagcgccctggagatcgtccagcagtgt
gaagaggtcgtcgggctctcttcggtggtggtggcctccggcagcgccggaacgcacgcc
gggttagctgtcgggctggaacatctgatgccggatgtcgaactgattggcgtgaccgtt
tcacgttctgtcgccgagcagaaacccaaagtgattgccttgcagcaggctattgccggc
cagctggcgctgacggcgacggcggatattcatttatgggatgactattttgccccgggt
tacggcgtgccaaatgacgcggggatggaggcggtgaaactgctggcgaacctggagggg
gtgctgctggatccggtatataccggtaaagcgatggcgggtctgatagatggcatcagc
cagaaacgctttaacgatgacgggccgattctctttattcataccggtggggcgcctgcg
ctgtttgcctaccatcctcatgtataa

DBGET integrated database retrieval system