KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_0317Help
Entry
SL1344_0317       CDS       T01724                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sey01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sey00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
365793..366896
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDT
LRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIASGSKPG
VIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAMLERGSSLLPKGI
KSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtcgtaaaactcggcaccagcgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgtagaacttgtccgccagtgcgcgcagttacacgcc
gcgggacatcgtattgttattgttacctctggcgcgattgccgccggacgtgaacatctc
ggctacccggaactgccggcaacaattgcctctaaacagcttctggcggcggtagggcaa
agccgcttgattcaactgtgggagcagttgttttcaatttacggtatccatatcgggcag
atgctgttgacgcgtgcggatatggaagacagagagcgctttctgaacgcccgcgatacg
ctacgtgcattactggataaccatattgtgccggttatcaatgaaaatgatgccgttgcg
acagcggaaattaaagtgggcgacaacgataacctctccgcgctggcggcgatcctggca
ggcgcggataaactgctgctgctgaccgatcagcaaggattatttaccgccgatccgcgt
agcaatccgcaggcggagcttatcaaagatgtgtatggcgttgacgatgcgctgcgctct
atcgcgggagacagcgtttccgggctgggaaccggtggtatgagcactaagcttcaggcg
gcagacgtggcctgtcgcgcgggtattgatacgattattgcctcaggcagtaaaccgggc
gtgatcggcgatgtgatggaggggatttccgtcggcacccgttttcatgcgcaagcctcg
ccgctggaaaaccgcaaacgttggatcttcggcgcgccgccggcaggtgaaattacggtt
gatgaaggcgcgaccgcggcaatgctggaacgtggcagttcacttctgccaaaaggcatc
aaaagcgtgacgggcaatttctcgcggggggaggtcatcagaatttgtaacctgcaaggg
cgtgatattgctcatggcgtcagccgttataacagtgatgctctgcggcggatagccggt
caccactctcaacaaatcgatgcgattctgggctatgaatatggcccggtcgctgttcat
cgtgatgacatgattactcgataa

DBGET integrated database retrieval system