KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_0479Help
Entry
SL1344_0479       CDS       T01724                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sey00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SL1344_0479 (recR)
DNA repair and recombination proteins [BR:sey03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SL1344_0479 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
542698..543303
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAEAGVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgttaactcagcttatggaagcgttgcgctgccttccgggcgtt
ggccctaagtcggcgcagcggatggcgtttaccctgttgcagcgcgatcgcagcggcgga
atgcgcctggcgcaggcgctgactcgggcgatgtcggaaatcggccactgcgccgactgc
cgcacctttaccgagcaggatgtttgtaatatctgctcgaacccgcggcgtcaggaaaac
ggccagatttgcgtggtggagagtcctgcggatatctacgccattgagcagaccgggcaa
ttttccgggcggtatttcgtgctgatgggccacctgtcgccgctggacggcatcgggccg
gatgatatcggtcttgatcgtctggaacagcggctggcgtcagaaaaaatcagtgagctg
atcctcgcgaccaacccgacggttgaaggggaggctaccgcgaactatattgccgagctg
tgcgcggaggccggcgtcgaagccagtcgtatcgcccacggcgtgccggttggcggcgaa
ctggagatggtcgacggtacgacgctgtcccactcgctggcgggacgccataagattatt
ttctga

DBGET integrated database retrieval system