KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_1224Help
Entry
SL1344_1224       CDS       T01724                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL1344_1224
Enzymes [BR:sey01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SL1344_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(1324327..1325211)
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLW
LSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFE
LQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGL
GDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaatttttgccctcccggttatcgaacagcttacccctgtcctttcccgt
cgtcagcttgatgacctggatctgatcgtcgttgaccatccgcaggttaaagcctctttt
gcattacagggcgcgcaccttctctcctggaaacccgttggcgaggaagaggtattgtgg
ctcagtaataatacgcctttcaaaaccggcgtggcgctacgcggcggtgtaccgatctgc
tggccctggtttggacctgcggctcaacagggtctgccgtcacacggctttgcgcgtaat
cttccgtgggcgctaaaagcgcataatgaagatgataatggcgtaatgctgacatttgag
ctgcaaagcagtgaggccacccggaaatactggccgcacgatttcacgctgctggcacgt
tttaaagtgggtaaaacctgtgaaattgaactggaagcgcatggcgaatttgcaaccaca
tccgcgctccacagctattttaacgttggcgacatcgccaacgttaaggtcagcggactc
ggcgatcggtttattgataaagttaacgacgctaaagaaggtgtcctgaccgacggtata
caaacctttccggaccgtaccgatcgcgtttacctcaatcctgaagcatgtagcgtgatc
cacgatgcgacattaaaccgcacgattgatgtggtccaccaccatcaccttaacgtcgta
ggctggaaccctggcccggcgttgtccgtcagcatgggcgacatgccggatgacggctat
aaaacgtttgtctgcgttgaaacggtttacgctactgcgccgcaacaagccacagaagaa
aaaccctctcgtctggcgcagactatctgcgtcgctaaacgctaa

DBGET integrated database retrieval system