KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_1261Help
Entry
SL1344_1261       CDS       T01724                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase isozyme
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00010  Glycolysis / Gluconeogenesis
sey00030  Pentose phosphate pathway
sey00051  Fructose and mannose metabolism
sey00052  Galactose metabolism
sey00680  Methane metabolism
sey01100  Metabolic pathways
sey01110  Biosynthesis of secondary metabolites
sey01120  Microbial metabolism in diverse environments
sey01130  Biosynthesis of antibiotics
sey01200  Carbon metabolism
sey01230  Biosynthesis of amino acids
Module
sey_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sey_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL1344_1261 (pfkB)
   00030 Pentose phosphate pathway
    SL1344_1261 (pfkB)
   00051 Fructose and mannose metabolism
    SL1344_1261 (pfkB)
   00052 Galactose metabolism
    SL1344_1261 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SL1344_1261 (pfkB)
Enzymes [BR:sey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SL1344_1261 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: CBW17357
UniProt: A0A0H3NAQ9
Position
complement(1361943..1362875)
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLDDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGDALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSRDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcaccgcgaccgccattttcccg
gctggcggcgctaccggcgaacatcttgtcgcactactggctgacgaaaatgtccccgtg
tctaccgtcgatgcgaaggactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacagtatcgttttgttatgcccggcgccacgctggacgatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcgcagaagcaaggc
attcgctgcattattgatagctctggcgacgcgctcaccgccgcgctggcgcttggcgat
atcgaactggtgaaaccgaacctgaaagaattgagcgcgttggttaatcgtgatctgacg
cagcctgatgatgtgcgtaaagcggcccaggaattagtgcaaagcggcaaggctcgccgg
gtagtggtctctctggggccgcaaggggcgctgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgttggcgcaggcgacagtatggtaggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgcttcggtgtg
gcggcaggcagcgctgctacgctcaatcaaggtacgcgtctgtgttctcgtgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system