KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_1497Help
Entry
SL1344_1497       CDS       T01724                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SL1344_1497 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL1344_1497 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SL1344_1497 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SL1344_1497 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SL1344_1497 (adhP)
   00626 Naphthalene degradation
    SL1344_1497 (adhP)
Enzymes [BR:sey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SL1344_1497 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1604728..1605657
Genome map
AA seq 309 aa AA seqDB search
MLKMECCGVCHTDLHVKNGDFGDKTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYE
GCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEECIVVADYAVKVPEGLDSAAASSITCAG
VTTYKAVKISHIKPGQWIAIYGLGGLGNLALQYAKNVFNAKVIAIDVNDGQLKLAEEMGA
DLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPEAMNL
DIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEGKVVPKVALRPLEDINVIFKEMEQGQIR
GRMVIDFRR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaaatggagtgctgcggcgtatgccataccgatctacacgtgaaaaacggcgat
ttcggtgacaaaaccggcgttattctgggacacgaaggcattggcgtcgtggcggaagtc
ggtcctggtgtcacctcgctgaaacccggcgatcgcgcgagtgtcgcgtggttttatgaa
ggatgcggacactgtgagtattgcaatacgggcaatgaaaccttatgccgcaacgtgaaa
aatgccggttacacggtagatggcggtatggccgaagagtgtattgtcgtcgcggattat
gcggtgaaagtaccggaaggtctggactctgcagcggcaagtagtattacctgcgcgggc
gttaccacctataaagcggtgaagatttctcatattaaacctggccagtggattgccatc
tacggtctgggcggtctgggtaatctggccttgcagtacgcgaaaaacgttttcaatgcg
aaagtgattgccattgatgtcaatgatggacaactgaaactggccgaggaaatgggcgca
gatctgaccattaattcacgtacggaagatgcggctaaaattgtgcaggaaaaaaccggt
ggcgcgcacgcagcggtggttaccgcggtcgctaaggcggcgtttaattccgcagtagat
gccgttcgcgccggaggccgcgtggtggcagtcgggttgccgccagaagccatgaacctt
gatatccctcgcctggtgctggatggcattcaggttgtcggttcgttggtggggacacgc
caggatctgaccgaagccttccagtttgcggcggaaggaaaagtcgtgccaaaagtcgct
ttacgtccgcttgaagatatcaacgttatttttaaagagatggaacagggacaaattcgt
ggccgtatggtcatcgatttccgtcgttaa

DBGET integrated database retrieval system