KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_1656Help
Entry
SL1344_1656       CDS       T01724                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SL1344_1656 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SL1344_1656 (trpC)
Enzymes [BR:sey01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SL1344_1656 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SL1344_1656 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1778564..1779922
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIASIYQHYASAISVLTDEKYFQGSFDFLPVVSQSAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLKMGVLTEVSNDEERERAIALGAKV
VGINNRDLRDLSIDLNRTRQLAPKLGHGVTVISESGINTYGQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRAQDAKAACDAGAIYGGLIFVPSSPRAVSVEQAREVI
SGAPLQYVGVFKNADIADVCQKAAVLSLSAVQLHGSEDQAYVNALREALPKQVQIWKALS
VSDALPARDYHHVDKYIFDNGQGGSGQRFDWSLLQGQPLDNVLLAGGLAADNCVQAAQVG
CAGLDFNSGVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcaacagccgctggccagttttcaaaatgagatccagccaagtacacgccatttttat
gatgcgctccagggcgcgcgtaccgcctttattctggagtgtaagaaagcatcgccatca
aaaggcgtgattcgcgacgatttcgatccggcgcgtattgccagtatttatcaacattac
gcctcggcgatctcggtgctcaccgacgaaaaatattttcaggggagcttcgattttctg
ccggtcgttagccaaagcgcgccgcagccgattctgtgtaaggattttattatcgatccc
tatcagatctaccttgcccgttactatcaggccgatgcctgtttactgatgctctcggtt
ctggatgacgaacagtatcgccaactctccgccgtcgcgcacagtctgaaaatgggcgtg
ctcacggaggtcagtaatgacgaagaacgggagcgcgcgatagcgttaggcgcaaaagtg
gtaggtatcaacaatcgcgatctgcgcgatctgtcgattgatttgaatcgcacccgccag
ctggcgccaaaactgggccacggcgtgactgtcatcagcgagtccgggattaacacctat
ggtcaggtacgcgaactgagccacttcgccaacggttttttaattggctccgcgttaatg
gcgcatgacgatcttaacgccgccgtccgtcgcgtgctgcttggcgaaaataaagtctgc
ggcctgacccgcgcccaggacgctaaagcggcctgtgacgctggcgcaatatatggcggg
ttgatttttgtgccctcatctccgcgcgcggttagcgttgagcaggcgcgagaagtgata
agcggcgcgccattgcagtatgtcggcgttttcaagaacgctgatatcgccgatgtttgc
cagaaagccgccgtcctgtcgctttctgccgtacagctacatggcagcgaagaccaggcg
tatgtcaacgcgctgcgcgaggcgttgccgaaacaggtgcaaatctggaaggcgctgagc
gttagcgatgcccttcccgcacgcgattatcaccatgtcgataaatacattttcgacaat
gggcaaggcggcagcgggcagcgcttcgactggtcactgctacaggggcaaccgctggat
aatgtgttactggcgggcgggctggcggccgataactgcgtccaggcggcgcaagtcggc
tgtgccggtctcgattttaattcaggtgtggagtcacagccgggcatcaaagatgctcgt
cttctggcctcagtttttcagacactgcgcgcatattaa

DBGET integrated database retrieval system