KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_1680Help
Entry
SL1344_1680       CDS       T01724                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00010  Glycolysis / Gluconeogenesis
sey00071  Fatty acid degradation
sey00350  Tyrosine metabolism
sey00620  Pyruvate metabolism
sey00625  Chloroalkane and chloroalkene degradation
sey00626  Naphthalene degradation
sey00650  Butanoate metabolism
sey01100  Metabolic pathways
sey01110  Biosynthesis of secondary metabolites
sey01120  Microbial metabolism in diverse environments
sey01130  Biosynthesis of antibiotics
sey01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL1344_1680 (adh)
   00620 Pyruvate metabolism
    SL1344_1680 (adh)
   00650 Butanoate metabolism
    SL1344_1680 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SL1344_1680 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SL1344_1680 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SL1344_1680 (adh)
   00626 Naphthalene degradation
    SL1344_1680 (adh)
Enzymes [BR:sey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SL1344_1680 (adh)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SL1344_1680 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: CBW17775
UniProt: A0A0H3NLV7
Position
1799981..1802659
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYMLQGQELKAVQNVILKNGALNAAIVGQP
AYKIAELAGFSVPETTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEEAVEKAEKLV
AMGGIGHTSCLYTDQDNQPERVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDFTEGEVAAKKDVVAAPKAEKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaggtcgacaaaatcttccgcgccgccgctctg
gctgccgctgatgcccgcattccgctggccaaaatggccgtcgccgaatccggtatgggt
atcgtggaagacaaagtgattaaaaaccacttcgcttctgaatatatttacaacgcctat
aaagatgaaaaaacctgcggcgtgctgtctgaagacgacaccttcgggaccatcaccatt
gctgaacctatcggcattatttgcggtatcgttccaaccactaacccaacctctaccgcg
atcttcaaatcgctgattagcctgaagacccgtaacgccatcatcttttctccgcatccg
cgcgctaaagaagcaaccaacaaagcggcagacatcgttctgcaagcggctatcgctgcc
ggcgcgccgaaagatctgattggctggatcgatcaaccttccgtagaactgtctaacgcg
ttgatgcaccacccggatattaacctgatcctcgccactggcggtccaggcatggttaaa
gctgcatacagctccggtaaaccggctatcggcgtaggcgcaggcaacactccggttgtc
attgatgaaaccgctgatatcaaacgcgctgtggcgtctgttctgatgtctaaaaccttc
gataacggcgtaatctgtgcttctgaacagtctgttgtcgttgttgattccgtctatgat
gccgttcgcgaacgtttcgccagccatggcggctacatgctgcagggccaggagctgaaa
gcggttcaaaacgttatcctgaaaaatggcgctctgaacgccgctatcgtcggccagcca
gcctacaaaatcgctgaactggcaggcttctccgtaccagaaaccaccaagattctgatc
ggtgaagttacggtcgttgacgaaagcgaaccgttcgcacacgaaaaactgtctccgact
ctggcgatgtatcgtgcgaaagatttcgaagaagcggtagaaaaagcagaaaaactggtc
gctatgggcggtatcggtcacacctcctgcctgtacactgaccaggataaccagccagaa
cgcgttgcttacttcggtcagatgatgaaaaccgcgcgtatcctgatcaacaccccggcc
tctcagggtggtatcggtgacctgtacaacttcaaactcgcaccttccctgacgttgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctctctgcccatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaacggctatgcagaccagatcacc
tctgtgctgaaagcggctggcgttgaaaccgaagtcttcttcgaagttgaagcagacccg
acgctttccgttgttcgcaaaggcgctgagctggctaactccttcaaaccggacgtgatc
atcgcgctgggcggcggttccccgatggacgccgcgaaaatcatgtgggtcatgtacgaa
catccggaaactcacttcgaagaactggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggt
accggttctgaagtcacaccgtttgcggttgtgaccgacgatgcaaccggtcagaaatat
ccgctggctgactacgccctgaccccggatatggcgattgtcgacgccaacctggtgatg
gatatgccgaagtccctgtgtgcgttcggtggtctggatgcggtaactcacgctctggaa
gcttatgtttccgtactggcttctgagttctctgacggtcaggctctgcaggctctgaaa
ctgctgaaagaaaacctgccggcgtcttaccacgaaggttccaagaacccggttgcgcgt
gaacgtgttcacagcgccgcgactatcgccggtatcgcgtttgccaacgccttcctcggt
gtatgtcactccatggcgcacaaactgggctctcagttccacattccgcacggtctggcg
aacgccctgctgatttgtaacgttatccgctacaacgcgaatgacaacccgaccaagcag
accgctttcagccagtacgatcgtccgcaggcacgccgtcgttacgctgaaattgctgac
cacctgggcctgagcgcgccgggcgaccgtaccgctgctaagattgaaaaactgctggca
tggctggaaagcattaaagctgagctgggtattcctaagtctatccgtgaagcaggcgta
caggaagctgacttcctggcacacgttgacaaactgtctgaagatgccttcgatgaccag
tgcaccggcgctaacccgcgttatccactgatctccgaactgaaacagattctgctggat
acctactacggtcgtgatttcaccgaaggtgaagttgcagcgaagaaagacgtcgttgcc
gcaccgaaagcagagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system