KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_2071Help
Entry
SL1344_2071       CDS       T01724                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SL1344_2071 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SL1344_2071 (rfbC)
Enzymes [BR:sey01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SL1344_2071 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(2172833..2173384)
Genome map
AA seq 183 aa AA seqDB search
MMIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKKNVLR
GLHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAH
GFVTLSEYAEFLYKATNYYSPSSEGSILWNDEAIGIEWPFSQLPELSAKDAAAPLLDQAL
LTE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgatgattgtgattaaaacagcaataccagatgtcttgatcttagagcctaaagttttt
ggcgatgagaggggattcttttttgaaagttataaccagcagacctttgaagagttgatt
ggacgtaaagttacatttgttcaagataatcattcaaaatccaaaaagaacgtactcaga
gggctacattttcagagaggagaaaatgcacaggggaagttagttcgttgtgctgtcggt
gaggtttttgatgttgcggtcgatatccgaaaagaatcgcctacttttggtcaatgggtt
ggtgtaaatctgtctgctgagaataagcgacagctttggattccagaaggttttgctcat
ggttttgttactcttagtgagtatgcagagtttctgtacaaagcaactaattattactca
ccttcatcggaaggtagcattctatggaatgatgaggcaataggtattgaatggcctttt
tctcagctgcctgagctttcagcaaaagatgctgcagcacctttactggatcaagccttg
ttaacagagtaa

DBGET integrated database retrieval system