KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_2075Help
Entry
SL1344_2075       CDS       T01724                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SL1344_2075 (galF)
   00052 Galactose metabolism
    SL1344_2075 (galF)
   00500 Starch and sucrose metabolism
    SL1344_2075 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    SL1344_2075 (galF)
Enzymes [BR:sey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SL1344_2075 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2176672..2177694)
Genome map
AA seq 340 aa AA seqDB search
MLWCRLRRNVERAIIIPGSRVIHAGENKLKSYNSATILQVEETMMNLKAVIPVAGLGMHM
LPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASKNAVENHFDTSYELESLL
EQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPVVGDNPFIVVLPDIIIDD
ATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTKEPLDNEGKVSRIVEFIE
KPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTDAIAELAKKQSVDAMLMT
GDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttatggtgccgactaagacgtaatgtagagcgtgccatcattatccctggcagcaga
gtaattcatgctggcgaaaacaagctaaagagctataattcagcaaccattttacaggtg
gaagaaacaatgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatg
ttgcctgccaccaaggcaatcccaaaagagatgctaccgatcgtcgacaagccaatgatt
cagtacattgtcgatgagattgtggctgcagggatcaaagaaatcgtgctggtgactcac
gcgtctaaaaacgccgttgagaaccacttcgacacctcttatgaacttgaatcacttctt
gagcagcgcgttaagcgtcagcttttggcggaagtgcaatctatctgcccaccgggcgtg
acgattatgaacgttcgccaggcgcagccgttagggctggggcattctattctgtgcgcg
cgtccggtcgtgggcgataaccctttcattgtggtactcccggatattattatcgatgat
gctaccgccgatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacg
ggtcgcagccaggtgctggcgaagcgcatgaaaggtgatttatcggagtattccgttatc
cagacgaaagaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaa
aaaccggatcagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctt
tcagccgacatctgggcggaactggaaagaaccgaaccgggcgcctggggccgcatccag
ctcaccgatgccattgctgaactggcgaaaaaacagtcggttgacgcgatgctaatgacg
ggtgacagctatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacggg
ctgcgcaacctgaaagaaggagccaagttccgtaagagcatagagcagcttttgcatgaa
taa

DBGET integrated database retrieval system