KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_2686Help
Entry
SL1344_2686       CDS       T01724                                 

Gene name
nucD2
Definition
putative lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Brite
Enzymes [BR:sey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SL1344_2686 (nucD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2870219..2870689)
Genome map
AA seq 156 aa AA seqDB search
MLAIAATLPGFQSLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIGNTSGVVPGKTITE
RQAAQGLITNVLRVERALDKCVVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRW
ADACHQLPRWVYVKGVFNQGLDNRRAREMAWCLKGV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgctggctatcgccgccacgctgcccggatttcagtcgcttcatacctccgttgagggg
ctgaaactgatcgccgattacgagggatgccgcctgcagccttatcagtgcagcgcgggc
gtctggactgacgggatcggcaatacgtccggtgtggtgcctggaaaaaccatcacggaa
cggcaggcggcgcagggacttatcaccaacgtgctgcgcgtggagcgggcactggataaa
tgtgtggtacagccgatgccgcaaaaggtctatgacgcggtggtgtcgtttgctttcaac
gtgggcaccggcaacgcctgcagctccacgctggttaagttgctgaaccagcggcgctgg
gcggatgcctgccatcagctgccgcgctgggtatatgtcaaaggtgtgtttaatcagggg
ctggacaaccgccgcgcgcgggaaatggcctggtgcttaaaaggagtatag

DBGET integrated database retrieval system