KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_3019Help
Entry
SL1344_3019       CDS       T01724                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Brite
Enzymes [BR:sey01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SL1344_3019 (dsbC)
Secretion system [BR:sey02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SL1344_3019 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(3224408..3225082)
Genome map
AA seq 224 aa AA seqDB search
MFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMY
DVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYN
ALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYA
LGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgttttcaggcgtggcccatgcggatgatgcggctatccgtcagtcgctggctaagctg
ggcgttcagagtacggaaattcaggcctcgccagtggcagggatgaaaaccgtcctcact
cacagcggcgtactgtacgtcactgatgacggcaaacatattattcaagggccgatgtat
gacgtgagcggcgcgcatccggtaaacgtgacgaacaaactgctgatgagccagctaaat
gcgctggaaaaagagatgatcgtctataaagcgccggatgagaaacatgtcattactgtt
tttaccgatatcacctgcggctattgtcataagctacatgaagagatgaaagattataac
gcgctggggatcacggtacgttatctggcttttccgcgccaggggctggaaagccaggcg
gagcaggatatgaaatctatctggtgcgccaaagacaaaaacaaagcgtttgatgacgcc
atggcaggtaagggcgtgaaaccggcaagctgtgacgtgaacattgctgatcattatgcg
ttgggcgtgcagttgggcgttagcggtacgccagccattgtattgagtaacggctatgtg
gtgcctggctatcagggaccgaaagagatgaaagcgtttcttgatgagcatcaaaaacag
accagtggtaaataa

DBGET integrated database retrieval system