KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_3027Help
Entry
SL1344_3027       CDS       T01724                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00010  Glycolysis / Gluconeogenesis
sey00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL1344_3027 (bglA)
   00500 Starch and sucrose metabolism
    SL1344_3027 (bglA)
Enzymes [BR:sey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SL1344_3027 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: CBW19126
UniProt: A0A0H3NLU9
Position
3230027..3231460
Genome map
AA seq 477 aa AA seqDB search
MRKLTLPKDFLWGGAVAAHQVEGGWNKDGKGPSICDVLTGGAHGVPREITQNVVAGKYYP
NHEAVDFYGHYKEDIRLFAEMGFKCFRTSIAWTRIFPNGDESQPNEAGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQHYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPQMKVGCML
AMVALYPFSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLE
VLREGTCDYLGFSYYMTNAVKAEGGSGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYSL
CELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactcaccttgccaaaagattttttatggggcggcgcggttgctgcacaccag
gttgaaggcggctggaataaagacggtaaaggccccagcatctgcgacgtgctaaccggc
ggcgcacacggcgtgccacgcgaaatcacccagaatgtcgttgctggcaaatactatccg
aaccacgaggcggtggatttttacggacattacaaagaagacatccgtcttttcgccgaa
atggggttcaaatgcttccgtacctctattgcctggacgcgtatcttcccgaatggcgac
gaatcccagccaaacgaggccggtctgaaattctacgacgacatgtttgatgagttactc
aaatacaacatcgaaccggtcattaccctttctcactttgaaatgccattacatctggta
cagcactacggcggctggaccaatcgtaaagtggttgatttctttgtccgttttgctgaa
gtcgtgtttgaacgctacaaacataaggtcaaatactggatgaccttcaacgaaattaac
aaccagcgaaactggcgcgcgccgctgtttggctactgctgttccggcgtggtgtatacc
gagcatgagaatccagaagaaaccatgtatcaggtcttacatcatcagtttgtcgccagc
gcgctggcggtaaaagcggcacgtcgcattaacccacagatgaaagttggctgtatgctg
gcgatggtcgcgctgtatcctttctcctgtaaaccagaagatgtgatgtttgctcaggag
tcgatgcgtgaacgctacgtctttaccgatgtgcagctgcgcggctattacccgtcctat
gtgttgaacgagtgggagcgccgcggatttaacatcaaaatggaagatggcgatcttgaa
gtgctgcgcgaaggcacctgcgattatcttggtttcagttattacatgaccaacgcggtc
aaagccgaaggcggtagcggcgatgcgatttccggttttgaaggcagcgtaccgaacccc
tatgttaaagcatctgactggggctggcagattgacccggtgggcctgcgttattcattg
tgtgaactgtacgaacgctatcaaaagccgctgtttattgtcgaaaacggttttggtgct
tacgacaaagtagaagaagatggcagcatcaacgacgactaccgaattgactacctgcgc
gcccatattgaagagatgaaaaaagcggtgacttacgatggtgtcgacctgatgggctac
acgccgtggggctgcatcgactgcgtgtcgttcaccaccggtcagtacagcaagcgctac
ggcttcatctacgtgaacaagcacgatgacggtacgggcgatatgtcgcgttcgcgtaag
aagagcttcaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system