KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_3626Help
Entry
SL1344_3626       CDS       T01724                                 

Gene name
xylA
Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SL1344_3626 (xylA)
   00051 Fructose and mannose metabolism
    SL1344_3626 (xylA)
Enzymes [BR:sey01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SL1344_3626 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3867782..3869104)
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGPQSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALELAKRKADVAFEFFHKLNVPFYCFHDVDVSPEGASLKEYKNNFA
QMVDVLAAKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKMGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVDANRG
DAQLGWDTDQFPISVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKIAARMVEDGELDKRVAKRYAGWNGELGQQILKGQLSLGELAQYAEQHNLAPV
HQSGHQELLENLVNRYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcttattttgaccaactcgatcgtgttcgctatgaaggccctcaatcgactaac
ccgctggcatttcgtcattacaatcccgacgagctggttttaggtaaacgtatggaagat
cacctgcgtttcgcggcctgttactggcataccttctgctggaacggcgcggatatgttt
ggtgtaggcgcgtttaatcgtccgtggcagcaaccgggcgaagcgctggagctggcgaaa
cgcaaagcggatgtggcgtttgaatttttccacaaactgaatgtgcctttttactgcttc
catgacgtggatgtgtcgccggaaggcgcgtcgttgaaagaatataaaaacaacttcgcg
cagatggtggatgtgctggcggcgaaacaggagcagagcggcgtaaaactgctgtgggga
acggcgaactgctttaccaacccgcgctatggcgcaggcgccgccactaacccggatccg
gaagtctttagctgggcagcgacgcaagtggttacggcaatgaacgccacgcataaactg
ggcggcgaaaattacgtcctgtggggcgggcgcgaaggttatgaaacgttgctgaatacc
gatctgcgccaggaacgcgaacagattggccgctttatgcaaatggtggtcgagcacaaa
cataaaatgggtttccagggcacactgctgattgaaccgaaaccgcaggaaccgacaaaa
catcagtatgattatgacgttgcaacggtctatggcttcctcaaacagttcggcctggaa
aaagagatcaaagtgaacattgaggcgaaccacgcgacgctggcgggccattcgttccac
catgaaatcgcaaccgctatcgcgctgggtatttttggctccgttgacgccaaccgcggc
gatgcgcaactgggctgggataccgatcagttcccgattagcgttgaagagaacgcgctg
gtgatgtacgaaatcctgaaagcgggcggattcacgacgggcggtctcaacttcgacgcc
aaagttcgtcgccagagcaccgataaatacgatctgttctacggtcatatcggcgcgatg
gatacgatggcgttgtcgctgaaaatcgccgcgcgtatggttgaagacggcgagctggat
aaacgcgtggcgaagcgctatgccggctggaatggcgagctgggtcagcagattctgaaa
ggacaactctccttaggcgaactggcgcagtatgcggagcagcataatctggcgccagta
catcaaagcggtcatcaggagctgttagaaaatctggttaaccgttatctgtttgataaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system