KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_3852Help
Entry
SL1344_3852       CDS       T01724                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SL1344_3852 (rbsK)
Enzymes [BR:sey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SL1344_3852 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4116922..4117851
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLIVLGSINADHILNLESFPTPGETVTGSHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDIGDSIRKQLVSDRIDIAPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVDAQRERIAQADALLMQLESPLESVLAAAKIAHQHHTTVALNPAPARELPDELLAL
VDIITPNETEAEKLTGVRVENDDDAAKAAQVLHDKGIRTVLITLGSRGVWASVDGEGRRV
PGFSVEAVDTIAAGDTFNGAFITAILEETPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IEAFLHQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggtaatctcatcgtccttggcagcattaatgccgatcatatccttaat
cttgagtccttccctaccccgggtgaaacggtaaccggtagccattatcaggtcgcgttt
ggtgggaaaggcgcgaatcaggcggttgctgcgggacgtagcggggcaaatattgcgttt
atcgcctgcacgggcgatgacgatattggcgacagtattcgtaaacaattagtcagcgat
cgtattgatatcgcgccagttagcgttattaaaggcgagtctaccggggtggcgctgatt
ttcgttaatggcgaaggcgagaacgtcatcggtattcatgccggagcgaatgccgcgtta
tcgccggcgttggttgatgcgcagcgtgaacgtatcgcgcaggcggatgcgttactgatg
caactggaatcgccgctggaaagcgtactggcggcggcgaaaatcgcccatcaacatcat
actactgttgcgcttaatccggcgcctgcccgtgagttaccggatgaactgctggcgctg
gtggacatcatcacgccaaatgaaacggaagctgaaaagctgacgggcgtgcgtgtggaa
aatgacgacgatgccgcgaaagctgcgcaggttttgcatgataaaggcattcgaaccgta
ttaattaccttaggaagccgtggcgtctgggccagcgtagacggcgagggccgccgcgtt
cctggatttagcgttgaggctgtcgataccattgctgccggagatacgtttaacggcgcc
tttatcaccgcgatactggaggagacgccgttgccggaagcgattcgctttgcccatgcc
gccgccgcgattgccgtaacgcgtaaaggcgcgcaaccttccgttccgtggcgcgaagag
atagaagcgtttttacatcagcaggggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system