KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_3915Help
Entry
SL1344_3915       CDS       T01724                                 

Gene name
pldB
Definition
(GenBank) lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SL1344_3915 (pldB)
Enzymes [BR:sey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SL1344_3915 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LIDHydrolase PGAP1
Motif
Other DBs
NCBI-ProteinID: CBW20006
UniProt: A0A0H3NUI5
Position
4187405..4188421
Genome map
AA seq 338 aa AA seqDB search
MFQQQNDWETRENAFAAFAMGPLTDFWRQREEAEFIGVGNIPVRFVRFRNDSNDRTIVIC
PGRIESYVKYAELAYDLFHLGFDIFIIDHRGQGRSGRMLSDPHRGHVDHFNDYVEDLAAF
WQQEIEPGPWRKRYILAHSMGGAIATLFLQRHRVRCDAIALTAPMFGIVIRLPSFMVRHI
LDWAEGHQRIREDYAIGTGQWRALPFGMNALTHSRQRYQRNLRFYADEPQLRVGGPTWHW
VREGILAGEQVLAGASDDTTPTLLIQAEEERVVDNRTHDRFCEIRAAAGYPCEGGKPLVI
KGAYHEILFEKDAMRSVALNAIVEFFNKPNLSSGNRFA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaatgactgggaaacaagagaaaatgcgtttgccgcttttgctatg
gggccgctgaccgatttctggcgtcagcgggaagaggcggagtttatcggcgtgggtaac
attccggtgcgctttgtccgttttcgaaatgattccaacgatcggacgatcgtcatttgt
cctggccgcattgagagttatgtaaaatacgctgaactggcgtatgacctttttcatctc
ggttttgatatcttcatcatcgaccaccgtggtcaagggcgctccgggcggatgttatcg
gacccgcatcggggtcatgtcgatcattttaacgattatgttgaggacttagcggcgttc
tggcagcaggaaattgagccggggccgtggcgtaagcgttatatcttggcgcactcaatg
gggggcgcgatagccaccctgttcctgcaacgccatcgtgtgcggtgcgacgctattgcg
ctcaccgcgccgatgtttggtattgtgatacgcttgccttcctttatggtgcgccatatt
ctcgactgggccgaagggcaccagcgtatccgtgaagattacgctattggtaccggtcag
tggcgggcgttgccgtttgggatgaatgcgctgacccacagccgccagcgttatcagcgc
aacttacgattttatgccgacgagccgcagctgcgcgttggcggccccacctggcattgg
gtacgcgaaggcattctggcgggtgagcaggtactggctggggcgagcgatgacacgacg
cctacgctactgattcaggcggaagaagagcgggtagtggataaccgcacccacgatcgt
ttttgtgaaattcgcgccgcggcgggatacccttgtgaagggggaaaaccgctggttatc
aaaggcgcgtaccatgagatcctttttgaaaaggacgccatgcgctcagtcgcgcttaac
gccattgttgaatttttcaacaagcctaatttatccagcggaaatcgctttgcttag

DBGET integrated database retrieval system