KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_4227Help
Entry
SL1344_4227       CDS       T01724                                 

Gene name
proP
Definition
putative amino acid permease
Orthology
K03762  
MFS transporter, MHS family, proline/betaine transporter
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4552262..4553764
Genome map
AA seq 500 aa AA seqDB search
MLKRKKIKPITLGDVTIIDDGKLRKAITAASLGNAMEWFDFGVYGFVAYALGKVFFPGAD
PSVQMIAALATFSVPFLIRPLGGLFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYA
TIGIWAPILLLLCKMAQGFSVGGEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGA
GVVVLISTIVGEENFLEWGWRIPFFIALPLGIIGLYLRHALEETPAFQQHVDKLEQGDRE
GLQDGPKVSFKEIATKHWRSLLSCIGLVIATNVTYYMLLTYMPSYLSHNLHYSEDHGVLI
IIAIMIGMLFVQPVMGLLSDRFGRRPFVIMGSIALFALAIPAFILINSNVIGLIFAGLLM
LAVILNCFTGVMASTLPAMFPTHIRYSALAAAFNISVLIAGLTPTLAAWLVESSQDLMMP
AYYLMVIAVIGLITGISMKETANRPLKGATPAASDIQEAKEILGEHYDNIEQKIDDIDQE
IAELQVKRSRLVQQHPRIDE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaggaaaaaaataaaaccgattacactgggcgatgtgaccatcattgatgat
ggtaaacttcgcaaagcgattaccgccgcctcgctgggcaacgcgatggagtggtttgat
tttggtgtttatggatttgttgcctacgcgttgggtaaagtctttttccccggcgccgat
cccagcgtccagatgattgccgcgctggccacgttttccgttcccttcctgattcgtccg
ctcggcgggttattctttggtatgctcggcgataaatacgggcgccagaagatcctggcg
atcacgattgtgattatgtcgatcagtaccttctgtatcgggttaatcccctcttacgcg
acgatcggtatctgggcgccaatactgttgttgctgtgtaaaatggcgcagggcttctcg
gttggcggggaatataccggcgcgtcgatctttgtcgcggaatattcgccggatcgtaaa
cgcggatttatgggaagctggctggattttggttctatcgccggattcgtgctgggcgcg
ggcgtggtggtcttgatctcgacgattgtcggcgaggagaatttccttgagtggggctgg
cgtattccgttctttatcgccctgccattggggattattggtctctacttacgccatgcg
ctggaggagacgccagcgtttcagcagcacgtggataaactggagcagggcgaccgcgaa
gggttgcaggatgggccgaaagtctcctttaaagagattgccaccaaacactggcgtagc
ctgttgtcatgtatcggtctggtgattgccaccaacgtgacctactacatgctgctcacc
tacatgccgagctacctgtcgcataacctgcactattctgaagatcacggcgtgttgatt
atcatcgccattatgatcgggatgctgtttgtgcagccggtgatggggctgctgagcgac
cgtttcggtcgacgtccatttgtgattatgggcagcattgcgctgttcgcgctggcgatc
ccggccttcatcctgattaacagtaacgttattggcctgatttttgcaggtttgttgatg
ctggcggtgattctgaactgctttaccggggtgatggcctcgacattgccggcgatgttt
ccgacgcatattcgttatagcgcgctggcggcggcttttaatatctctgtattgattgcc
ggtctgacgccaacgctggcggcctggctggtggaaagctcgcaggatctgatgatgccg
gcgtattatttgatggtcatcgcggtgataggcttgattaccggtatttccatgaaagag
acggccaatcgtccgttaaaaggcgcaacgccagcggcgtcggacatccaggaagcgaag
gaaattctgggcgagcattacgataatattgagcagaaaatcgacgacatcgatcaggaa
attgcggagctgcaggtcaaacgttcgcgtctggtacagcaacatccgcgtatcgatgaa
taa

DBGET integrated database retrieval system