KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_4358Help
Entry
SL1344_4358       CDS       T01724                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SL1344_4358
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SL1344_4358
Enzymes [BR:sey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SL1344_4358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
4689596..4690939
Genome map
AA seq 447 aa AA seqDB search
MKGRLISSDPYRQQFLVERAVSFSHRQRDCSELISVLPRHALQQIDGFGGSFTEGAGVVF
NSMSEKTKAQFLSLYFSAQEHNYTLARMPIQSCDFSLGNYAYVDSSADLQQGRLSFSRDE
AHLIPLISGALRLNPHMKLMASPWSPPAFMKTNNDMNGGGKLRRECYADWADIIINYLLE
YRRHGINVQALSVQNEPVAVKTWDSCLYSVEEETAFAVQYLRPRLARQGMDEMEIYIWDH
DKDGLVDWAELAFADEANYKGINGLAFHWYTGDHFSQIQYLAQCLPDKKLLFSEGCVPME
SDAGSQIRHWHTYLHDMIGNFKSGCSGFIDWNLLLNSEGGPNHQGNLCEAPIQYDAQNDV
LRRNHSWYGIGHFCRYVRPGARVMLSSSYDNLLEEVGFVNPDGERVLVVYNRDVQERRCR
VLDGDKEIALTLPPSGASTLLWRQESI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcagactcatctcttccgatccgtatcgtcagcaattccttgttgagcgtgcg
gtctctttttcgcatcgtcagcgtgattgcagtgaattaatcagcgtcttaccgcgccac
gcgttacagcagattgacggattcggcggcagctttaccgaaggtgcgggcgtggtattc
aacagcatgagcgaaaagacgaaggcgcaatttctttccctttatttttctgctcaggaa
cataattacactctggcgcggatgccaattcagagctgtgatttttccctgggcaattac
gcgtatgtcgattccagcgctgacctgcagcagggacggctctccttttcccgcgatgaa
gcgcatttaataccgctgatttccggggcgttgcggttaaatccacacatgaagctgatg
gcttcgccgtggagtccgccggcgtttatgaaaactaataacgatatgaacggtggcggc
aagctgcggcgcgaatgctacgccgactgggccgatatcattatcaactacctgctggaa
taccgccgccacggcattaatgtgcaggcgctctccgtgcagaatgagccggtggcggta
aaaacctgggactcctgtctgtatagcgtggaagaggagacagcctttgccgtgcagtat
ctgcgtccgcgcctcgcccggcagggtatggatgagatggagatctatatctgggatcac
gataaagatggcctggtggactgggctgaactcgcctttgctgacgaagctaattataag
ggaattaacgggctggcattccactggtataccggcgaccatttttcgcaaatacagtat
ctggcccagtgcctgccggataaaaaactcctgttttccgaaggctgtgtgccaatggag
agcgatgccggtagccagattcgccactggcatacctatctccatgacatgattggtaat
ttcaaatcgggttgtagcgggtttatcgactggaatctgctgctgaacagtgagggcggg
ccgaatcatcagggtaatctgtgtgaagcgcccattcaatacgatgcgcaaaacgacgtg
ctgcggcgtaaccactcctggtatggtattggccacttctgccgctatgtgcgtccgggg
gcgagggtcatgctttcttcaagttacgataatcttctggaagaggtgggatttgtgaat
cccgacggcgagcgtgtgctggtggtgtataaccgcgatgtccaggaaaggcgttgccgg
gtgctggatggcgataaagagatcgcgttaacgctgccgccgtcaggcgccagtacgttg
ctatggcggcaggagtcgatctga

DBGET integrated database retrieval system