KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_4391Help
Entry
SL1344_4391       CDS       T01724                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sey00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sey00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4724553..4725488)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GQVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHIAMVGDLKYGRTVHSLTQALAKF
SGNRFYFIAPDALAMPQYILDMLDEKGMAWSLHGSIEEVMADVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLNGARENMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQAL
LALVLNSELSL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccgctatatcaaaaacatatcatttccataaacgacctcagccgcgacgat
cttaatctggtactggcgacggcggcgaaattaaaagccaacccgcagccggagcttttg
aaacataaagtgatcgccagctgctttttcgaagcctccacgcgtacccgcctgtcgttt
gaaacttcaatgcatcgcctgggcgccagcgtagtgggcttctccgacagcgccaacacg
tcgctggggaaaaaaggagaaacgttagccgacacgatctcagtgattagcacttacgtg
gacgcgattgtgatgcgccatccgcaagaaggcgcggcacgtctggcgacggagttttcc
ggtcaggtgccggtgctcaatgcgggcgacggttcgaaccagcatccgacacagaccctg
ttggatctgttcaccatccaggaaacgcagggccgtctggataacttgcatatcgcgatg
gtcggcgatctgaaatatggccgcaccgtgcattcgctaacccaggcgctggcgaaattt
agcggcaaccgtttttattttatcgcgccggacgcgctggcgatgccgcagtacattctg
gatatgctggatgaaaaagggatggcctggagcctgcatggttctattgaagaggtcatg
gccgacgtcgacatcctctatatgactcgcgtacagaaagagcgtctcgacccgtcggag
tacgccaatgtgaaggcgcagtttgttctgcgcgccagcgacctgaacggcgcgcgtgaa
aatatgaaagtgctgcacccgctgccgcggattgatgaaatcaccacggatgtggataaa
acgccacacgcctggtacttccaacaggcgggcaacggtattttcgctcgccaggcgtta
ctggcgttagtactgaatagcgaactgagtctgtaa

DBGET integrated database retrieval system