KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_P3_0001Help
Entry
SL1344_P3_0001    CDS       T01724                                 

Gene name
sulII
Definition
dihydropteroate synthase type-2 (dihydropteroate synthase type ii) (dhps) (dihydropteroate pyrophosphorylase type ii) (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SL1344_P3_0001 (sulII)
Enzymes [BR:sey01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SL1344_P3_0001 (sulII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
pRSF1010_SL1344:complement(27..842)
Genome map
AA seq 271 aa AA seqDB search
MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVS
SDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAK
SSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFF
LGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAA
GGADFIRTHEPRPLRDGLAVLAALKETARIR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcgctcatcattttcggcatcgtcaacataacctcggacagtttctccgat
ggaggccggtatctggcgccagacgcagccattgcgcaggcgcgtaagctgatggccgag
ggggcagatgtgatcgacctcggtccggcatccagcaatcccgacgccgcgcctgtttcg
tccgacacagaaatcgcgcgtatcgcgccggtgctggacgcgctcaaggcagatggcatt
cccgtctcgctcgacagttatcaacccgcgacgcaagcctatgccttgtcgcgtggtgtg
gcctatctcaatgatattcgcggttttccagacgctgcgttctatccgcaattggcgaaa
tcatctgccaaactcgtcgttatgcattcggtgcaagacgggcaggcagatcggcgcgag
gcacccgctggcgacatcatggatcacattgcggcgttctttgacgcgcgcatcgcggcg
ctgacgggtgccggtatcaaacgcaaccgccttgtccttgatcccggcatggggtttttt
ctgggggctgctcccgaaacctcgctctcggtgctggcgcggttcgatgaattgcggctg
cgcttcgatttgccggtgcttctgtctgtttcgcgcaaatcctttctgcgcgcgctcaca
ggccgtggtccgggggatgtcggggccgcgacactcgctgcagagcttgccgccgccgca
ggtggagctgacttcatccgcacacacgagccgcgccccttgcgcgacgggctggcggta
ttggcggcgctgaaagaaaccgcaagaattcgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system