KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0043Help
Entry
Sez_0043          CDS       T00746                                 

Gene name
adh2
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sez_0043 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_0043 (adh2)
   00620 Pyruvate metabolism
    Sez_0043 (adh2)
   00650 Butanoate metabolism
    Sez_0043 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    Sez_0043 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sez_0043 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sez_0043 (adh2)
   00626 Naphthalene degradation
    Sez_0043 (adh2)
Enzymes [BR:sez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sez_0043 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sez_0043 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53419..56061
Genome map
AA seq 880 aa AA seqDB search
MTEKNSTVETTSVAATIDALVQKGLVALDKMRQLTQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPEDCVQWIET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYDEFVSEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKPAAWIAEQAGFTVPEGTNILAAECKEVSENEPLTREKLSPVIAV
LKAESRTDGVEKARQMVEFNGLGHSAAIHTADADLAKEFGTKIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPDFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFENLEKSVKEADFESREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEGVESYAKAVYDLGCRLGIKMNFRDQGIDEEEWKAHTRELA
YLAYEDQCSPANPRLPMVEHMEEIMNDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaatagtactgttgaaacaacatctgttgccgcaacaattgacgctctt
gttcaaaaaggtttagtagcgcttgataaaatgcgccaattaactcaagaacaggttgac
tacattgtagcgaaggcctctgttgctgctttggacgcacatggtgagttagctaagcat
gcctatgaagaaactggtcgtggagtttttgaagataaggctaccaaaaaccttttcgca
tgtgagcatgttgttaataacatgcgtcaccaaaaaacagtaggtatcattgaagaagac
gatgtaacaggtttgaccttaattgctgagccagtaggtgttatttgtgggattacccca
acaactaacccaacgtcaacagctatttttaaatctttaatctccttaaaaacacgtaac
cctattatttttgccttccacccatcagctcaagaatcatcagctcatgcagcacgcatt
gttcgtgatgcagccattgcagcaggagctcctgaggactgtgttcaatggattgaaacc
ccatcactggaagcaactaacgctctgatgaatcatgatggtattgcaacaatccttgca
actggtggtaatgctatggttaaggcagcctactcatgtggtaagccagctcttggggtt
ggtgctggtaacgtgcctgcctatgttgaaaaatccgctaacattcgtcaggcagcacac
gatattgtcatgtctaaatcatttgacaatggtatggtttgtgcttctgagcaggctgtt
attatcgacaaggagatttatgacgagtttgttagtgaatttaagtcttaccacacttac
tttgtcaacaaaaaggaaaaggctctgttagaggaattctgttttggtgccaaggctaat
agtaaaaactgtgcaggtgctaagctgaaccctaatattgttggtaagccagcagcttgg
attgctgagcaagctggctttacagtaccagaaggaacgaatatccttgcagcagaatgt
aaggaagtttctgaaaatgagccgttaacacgtgaaaaattgtcaccagttatcgctgtt
ttgaaggctgaatctcgcacagatggtgttgaaaaagctcgtcaaatggttgaatttaac
ggacttggtcactcagccgctatccatactgctgatgcagacttagctaaggaatttggg
acaaaaattcgtgctattcgtgtgatttggaattcaccttctacatttggtggtatcggt
gatgtttacaatgccttcctaccgtcattaacattgggctgtggttcttatggacgtaac
tcagttggtgataatgttagtgctgtaaatctcttgaatatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagttccttcaaaaacatacttcgagcgtgattcaatt
caataccttcaaaaatgtcgtgacgttgagcgtgtgatgattgttactgaccacgcgatg
gttgagcttggcttcttagatcgtatcatcgagcagcttgaccttcgtcgtaataaggtt
gtttatcaaatttttgcagatgtcgagccagatccagatatcacaacggttatgaaaggt
actgagttgatgcgtaccttcaagccagatacgattatcgctcttggtggaggttctcca
atggacgctgccaaggtgatgtggttattctacgagcaaccagaggttgacttccatgat
cttgttcaaaaattcatggatattcgtaagcgtgccttcaagttccctgagcttggtaag
aaaacaaaatttgtggctattccaacaacctcaggtacaggatcagaggttacaccgttt
gctgttatctcagataaggccaacaaccgcaagtacccaattgctgactattcattgaca
ccaacggtagccattgttgacccagcgttggtgcttacagtcccagacttcattgcagct
gatacaggtatggacgtattgacccacgcaaccgaggcttatgtatcacaaatggctaat
gactttacagacggtttggcccttcaagccattaagattgtctttgaaaaccttgaaaag
tctgttaaggaagctgattttgagtcacgtgaaaaaatgcataatgcctcaacaatggca
ggtatggcctttgctaatgccttcctaggtatttctcactcaatggctcataagattggt
gcacaattccatactgttcatggacgtaccaatgctatcttgcttccatacgttattcgt
tacaatggtacccgtcctgctaaaacagcaacatggcctaagtacaattactatcgcgct
gatgaaaaatatcaagacatcgctaaattgctagggcttccagcatctactccagaagaa
ggtgttgaatcctatgctaaagctgtttatgatcttggctgccgcttaggcattaagatg
aatttcagagatcaaggtattgacgaggaagaatggaaggcacacactcgtgagcttgct
tatcttgcctacgaggatcaatgctcacctgctaacccgcgcttaccaatggttgagcac
atggaagaaatcatgaatgatgcttattatggttacgcagagcgtccaggacgtcggaaa
taa

DBGET integrated database retrieval system