KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0045Help
Entry
Sez_0045          CDS       T00746                                 

Gene name
adh
Definition
Zn-dependent alcohol dehydrogenases and related dehydrogenases
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sez01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sez00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sez00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sez00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sez00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sez00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56556..57608
Genome map
AA seq 350 aa AA seqDB search
MKAATYVAPGQLELIDQPKPEILAPTDAVVRLLKTTICGTDLHILGGDVPETTHGTILGH
EGIGIVESVGSAVNNFKVGDKVIISCITACNTCYYCKKGIPAHCESGGWILGHLINGTQA
EYVHIPQADGSLYHAPKTVEDDALVMLSDIFPTSYEIGVQSAKVKPGDTVCIVGAGPIGL
AALLTAQFYSPAKLIMVDLSESRLEAAKRFGATDTICSGDLDDIVKKVHELTDGRGVDVA
IECVGYPATFDICQKIVAIGGHVSNVGVHGKPVSLDLQDLWIKNITMSTGLVNANTTEML
LNVLKSGKIDATKMVTHHFKLSEVEKAYEVFKNAGSNNALKVIIENDITA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctacatatgttgctccaggccagctggagcttattgatcaaccaaaacca
gagattcttgctccgacggatgctgtggttcgtttattgaaaacaacaatctgtggaaca
gatttgcatattttaggtggagatgtcccagagactactcatggtaccattttaggtcat
gaaggtattggtattgtcgagtcagttggctctgcagtgaataattttaaggtaggtgat
aaggttattatttcctgtatcacagcctgcaatacctgttattattgtaaaaaaggaatt
cctgctcattgtgaaagcggtggttggattctagggcatttgattaatgggacacaagca
gagtatgttcatattcctcaagcagatggcagcctttatcatgctcctaaaaccgttgag
gatgatgccttggttatgctatcagacattttcccaacttcctatgaaataggcgttcag
tctgcaaaggtaaaacctggtgacacagtgtgtatcgttggggcaggtcctatcggacta
gcagctcttttaacagcacaattttattcaccagctaagctgatcatggttgacttatca
gaatcacgtttagaagcggctaagcgctttggagcgacagatacgatttgttctggtgac
cttgatgatattgttaaaaaagtccatgaattaactgatggtcgaggcgttgatgttgct
attgagtgtgtgggctatcctgctacctttgatatctgtcaaaagattgttgctataggc
gggcatgtttctaacgttggtgttcatggaaaaccagttagcttggatctacaggaccta
tggatcaaaaatattacgatgtcaactggcctagtaaatgccaatacgacagaaatgcta
ttaaatgttctaaaatcaggtaagattgatgcaactaagatggtaacacatcactttaag
ctgtcagaggttgaaaaagcctatgaggtctttaaaaatgccggcagtaataacgccctt
aaagtgattattgaaaatgacattacagcctaa

DBGET integrated database retrieval system