KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0045Help
Entry
Sez_0045          CDS       T00746                                 

Gene name
adh
Definition
Zn-dependent alcohol dehydrogenases and related dehydrogenases
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sez_0045 (adh)
Enzymes [BR:sez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Sez_0045 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56556..57608
Genome map
AA seq 350 aa AA seqDB search
MKAATYVAPGQLELIDQPKPEILAPTDAVVRLLKTTICGTDLHILGGDVPETTHGTILGH
EGIGIVESVGSAVNNFKVGDKVIISCITACNTCYYCKKGIPAHCESGGWILGHLINGTQA
EYVHIPQADGSLYHAPKTVEDDALVMLSDIFPTSYEIGVQSAKVKPGDTVCIVGAGPIGL
AALLTAQFYSPAKLIMVDLSESRLEAAKRFGATDTICSGDLDDIVKKVHELTDGRGVDVA
IECVGYPATFDICQKIVAIGGHVSNVGVHGKPVSLDLQDLWIKNITMSTGLVNANTTEML
LNVLKSGKIDATKMVTHHFKLSEVEKAYEVFKNAGSNNALKVIIENDITA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctacatatgttgctccaggccagctggagcttattgatcaaccaaaacca
gagattcttgctccgacggatgctgtggttcgtttattgaaaacaacaatctgtggaaca
gatttgcatattttaggtggagatgtcccagagactactcatggtaccattttaggtcat
gaaggtattggtattgtcgagtcagttggctctgcagtgaataattttaaggtaggtgat
aaggttattatttcctgtatcacagcctgcaatacctgttattattgtaaaaaaggaatt
cctgctcattgtgaaagcggtggttggattctagggcatttgattaatgggacacaagca
gagtatgttcatattcctcaagcagatggcagcctttatcatgctcctaaaaccgttgag
gatgatgccttggttatgctatcagacattttcccaacttcctatgaaataggcgttcag
tctgcaaaggtaaaacctggtgacacagtgtgtatcgttggggcaggtcctatcggacta
gcagctcttttaacagcacaattttattcaccagctaagctgatcatggttgacttatca
gaatcacgtttagaagcggctaagcgctttggagcgacagatacgatttgttctggtgac
cttgatgatattgttaaaaaagtccatgaattaactgatggtcgaggcgttgatgttgct
attgagtgtgtgggctatcctgctacctttgatatctgtcaaaagattgttgctataggc
gggcatgtttctaacgttggtgttcatggaaaaccagttagcttggatctacaggaccta
tggatcaaaaatattacgatgtcaactggcctagtaaatgccaatacgacagaaatgcta
ttaaatgttctaaaatcaggtaagattgatgcaactaagatggtaacacatcactttaag
ctgtcagaggttgaaaaagcctatgaggtctttaaaaatgccggcagtaataacgccctt
aaagtgattattgaaaatgacattacagcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system