KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0046Help
Entry
Sez_0046          CDS       T00746                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sez_0046 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_0046 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Sez_0046 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sez_0046 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sez_0046 (adhA)
   00626 Naphthalene degradation
    Sez_0046 (adhA)
Enzymes [BR:sez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sez_0046 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
57813..58829
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQTSSGVEVVEHDVPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEKLGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVAGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVETAPEVFDEMERGLIQGRKVLDFTI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtagttgttaaccaaaccagcagtggtgtagaggttgtagagcatgatgta
ccatcaatcggtcatggagaagctcttgttaaagtagaatattgtggcgtatgtcatact
gacttgcatgttgcgcatggtgattttggtcaggttccagggcgtatcctcggtcatgaa
ggtatcggtattgttgaaaagctaggtgaaggcgttacctccttaaaggttggtgatcgt
gtatcaattgcttggttctttgaaggctgcggtcactgtgaatattgtacaacaggtcgc
gaaaccctatgccgttcagtcaaaaatgctggctattcagttgatggtgggatgagtgag
tatgcagttgttacagctgactatgctgtgaaagtgccagatggtcttgacccagctcaa
gcatcatcaattacctgtgcaggcgttacaacctataaggctatcaaagaagcaggtgcc
gctccaggacaatggattgttatctttggtgccggtggacttggtaacctagctgttcag
tatgctaaaaaggttttcaatgcccatgttgtagcagtggacattaacaacgataagcta
gagctggccaaggaggttggagcagatatcgttgtcaatggtaaagaaatcgaagatgtt
gcaggctatatccaagaaaaaacaggtggtgctcatggtgtcgtagtaactgctgtttct
aaagtagcctttaaccaagctattgatagtgtgcgtgcaggaggaactgttgttgctgta
ggacttccatcagaatacatggaattatctattgtaaaaactgttctagacggaatcaag
gtagtcggatcgcttgtaggaactcgtaaagacttggaagaagcctttgcctttggtgca
gaaggcttggttgtgccagttgtagaaaaggttccagttgagactgctccagaagtcttt
gacgaaatggaacgtggcctcattcaaggaagaaaggtattggatttcacgatttaa

DBGET integrated database retrieval system