KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0046Help
Entry
Sez_0046          CDS       T00746                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase I
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00010  Glycolysis / Gluconeogenesis
sez00071  Fatty acid degradation
sez00625  Chloroalkane and chloroalkene degradation
sez00626  Naphthalene degradation
sez01100  Metabolic pathways
sez01110  Biosynthesis of secondary metabolites
sez01120  Microbial metabolism in diverse environments
sez01130  Biosynthesis of antibiotics
sez01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_0046 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Sez_0046 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sez_0046 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sez_0046 (adhA)
   00626 Naphthalene degradation
    Sez_0046 (adhA)
Enzymes [BR:sez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sez_0046 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N DUF2675 ADH_N_2 Methyltransf_25 Methyltransf_31 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACG61429
UniProt: B4U4Z0
Position
57813..58829
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQTSSGVEVVEHDVPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEKLGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVAGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVETAPEVFDEMERGLIQGRKVLDFTI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtagttgttaaccaaaccagcagtggtgtagaggttgtagagcatgatgta
ccatcaatcggtcatggagaagctcttgttaaagtagaatattgtggcgtatgtcatact
gacttgcatgttgcgcatggtgattttggtcaggttccagggcgtatcctcggtcatgaa
ggtatcggtattgttgaaaagctaggtgaaggcgttacctccttaaaggttggtgatcgt
gtatcaattgcttggttctttgaaggctgcggtcactgtgaatattgtacaacaggtcgc
gaaaccctatgccgttcagtcaaaaatgctggctattcagttgatggtgggatgagtgag
tatgcagttgttacagctgactatgctgtgaaagtgccagatggtcttgacccagctcaa
gcatcatcaattacctgtgcaggcgttacaacctataaggctatcaaagaagcaggtgcc
gctccaggacaatggattgttatctttggtgccggtggacttggtaacctagctgttcag
tatgctaaaaaggttttcaatgcccatgttgtagcagtggacattaacaacgataagcta
gagctggccaaggaggttggagcagatatcgttgtcaatggtaaagaaatcgaagatgtt
gcaggctatatccaagaaaaaacaggtggtgctcatggtgtcgtagtaactgctgtttct
aaagtagcctttaaccaagctattgatagtgtgcgtgcaggaggaactgttgttgctgta
ggacttccatcagaatacatggaattatctattgtaaaaactgttctagacggaatcaag
gtagtcggatcgcttgtaggaactcgtaaagacttggaagaagcctttgcctttggtgca
gaaggcttggttgtgccagttgtagaaaaggttccagttgagactgctccagaagtcttt
gacgaaatggaacgtggcctcattcaaggaagaaaggtattggatttcacgatttaa

DBGET integrated database retrieval system