KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0052Help
Entry
Sez_0052          CDS       T00746                                 

Gene name
thnsl
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sez_0052 (thnsl)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sez_0052 (thnsl)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sez_0052 (thnsl)
Enzymes [BR:sez01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sez_0052 (thnsl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65600..67075
Genome map
AA seq 491 aa AA seqDB search
MYQSTRNAANKVTASQAILGGLADDGGLFTPTSMPVLDLDFEELKTKSYQEVTKLILSAF
FDDYTEAELDACISSAYDDKFDTAVIAPLATLKDYHNLELFHGPTIAFKDMALSILPYLL
TTAAKKQGVERKIAILTATSGDTGKAAMAGFADVPGTDIIVFYPKSGVSRIQELQMITQA
GHNTHVVAIEGNFDDAQTEVKRLFNDPDLRERLAAQQIQLSSANSMNIGRLIPQVVYYIY
AYAQLVRHQRLEAGETINIVVPTGNFGNLLAAYYAKEIGLPVAKFICASNENNVLTDFFA
SGRYDKKRPFKVTTSPSMDILVSSNLERLVFHLLGNDAQKTAVLMKSLAETGQYQLADAD
QSILDLFAAGFATEQETAKEIKTIFESDHYVLDPHTAVASAVYRAYREQSGDSRPTIVAS
TASPYKFPRVVVEAISGQQVASDFEALEQLADISGVVVPQAVNGLQEAPIRHSLLVTVAD
MQQAVEAYLGV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaatcaacaagaaatgcagctaataaggtaacggctagtcaagcgattttaggt
ggcctagcagacgatggtggcttgtttacccctacaagcatgccagtgttggatctagat
tttgaggagctaaaaaccaagtcctatcaagaggttaccaagcttattttatcagccttt
tttgatgactataccgaagcagagttagatgcttgtatctcttctgcctatgatgataag
tttgatacagcagtgatagcacctctagctacgttaaaggattatcataatttggagcta
tttcacggcccaaccattgcatttaaagacatggctctatctattttgccttatctcttg
acaactgctgctaaaaagcagggtgtagagcgaaaaattgcgattttaaccgctacctca
ggtgatactggtaaggcagcgatggcaggttttgctgatgttccgggaacggatattatt
gtcttttatcctaagtcaggcgttagcaggattcaggagctgcagatgatcacacaggcc
ggtcacaatacccatgttgtggcgattgaaggcaattttgatgatgctcaaacagaggtc
aagcgcctgtttaatgaccctgatttgcgtgagcggctagcagctcaacagatacagctg
tcttcggccaattcgatgaatattggtcgtttgattcctcaggttgtctattatatttat
gcttatgcccagttggtaaggcatcagcgacttgaagctggagagacgattaacatagta
gtgccgacaggaaattttggcaatctactggctgcctactacgccaaagaaattggactt
cctgttgccaaattcatctgtgcttccaatgaaaacaatgtcttgacagatttctttgct
agtggtaggtatgataaaaagcgtcccttcaaggtgactactagtccatcaatggatatt
ttggtgtcttcaaatttagagcgcttggtttttcatttactaggcaatgatgcccaaaag
acagcagtattaatgaagagcttggcagaaacaggtcagtatcagctagctgatgcagat
cagtctatccttgatttatttgcggcaggctttgcaacagagcaagagactgctaaagag
atcaaaacgatatttgagtctgatcattatgtgcttgacccacatacagctgtagcttca
gctgtttatcgtgcttatcgggagcaatcaggtgactctagaccgactattgttgcgtca
actgctagtccttataagtttccgcgggtagttgtggaagctattagtggtcagcaggtt
gccagtgattttgaggcgcttgagcagttggctgatatatcaggtgtagtcgtgccacaa
gcggtcaatggcttacaggaggcgcccattcgtcatagccttttagtgacagtagcagat
atgcagcaggcagtagaggcttatcttggagtatag

  All links  
No link information was found.   
DBGET integrated database retrieval system