KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0052Help
Entry
Sez_0052          CDS       T00746                                 

Gene name
thnsl
Definition
(GenBank) threonine synthase-like protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00260  Glycine, serine and threonine metabolism
sez00750  Vitamin B6 metabolism
sez01100  Metabolic pathways
sez01110  Biosynthesis of secondary metabolites
sez01120  Microbial metabolism in diverse environments
sez01230  Biosynthesis of amino acids
Module
sez_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sez_0052 (thnsl)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sez_0052 (thnsl)
Enzymes [BR:sez01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sez_0052 (thnsl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACG61435
UniProt: B4U4Z6
Position
65600..67075
Genome map
AA seq 491 aa AA seqDB search
MYQSTRNAANKVTASQAILGGLADDGGLFTPTSMPVLDLDFEELKTKSYQEVTKLILSAF
FDDYTEAELDACISSAYDDKFDTAVIAPLATLKDYHNLELFHGPTIAFKDMALSILPYLL
TTAAKKQGVERKIAILTATSGDTGKAAMAGFADVPGTDIIVFYPKSGVSRIQELQMITQA
GHNTHVVAIEGNFDDAQTEVKRLFNDPDLRERLAAQQIQLSSANSMNIGRLIPQVVYYIY
AYAQLVRHQRLEAGETINIVVPTGNFGNLLAAYYAKEIGLPVAKFICASNENNVLTDFFA
SGRYDKKRPFKVTTSPSMDILVSSNLERLVFHLLGNDAQKTAVLMKSLAETGQYQLADAD
QSILDLFAAGFATEQETAKEIKTIFESDHYVLDPHTAVASAVYRAYREQSGDSRPTIVAS
TASPYKFPRVVVEAISGQQVASDFEALEQLADISGVVVPQAVNGLQEAPIRHSLLVTVAD
MQQAVEAYLGV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaatcaacaagaaatgcagctaataaggtaacggctagtcaagcgattttaggt
ggcctagcagacgatggtggcttgtttacccctacaagcatgccagtgttggatctagat
tttgaggagctaaaaaccaagtcctatcaagaggttaccaagcttattttatcagccttt
tttgatgactataccgaagcagagttagatgcttgtatctcttctgcctatgatgataag
tttgatacagcagtgatagcacctctagctacgttaaaggattatcataatttggagcta
tttcacggcccaaccattgcatttaaagacatggctctatctattttgccttatctcttg
acaactgctgctaaaaagcagggtgtagagcgaaaaattgcgattttaaccgctacctca
ggtgatactggtaaggcagcgatggcaggttttgctgatgttccgggaacggatattatt
gtcttttatcctaagtcaggcgttagcaggattcaggagctgcagatgatcacacaggcc
ggtcacaatacccatgttgtggcgattgaaggcaattttgatgatgctcaaacagaggtc
aagcgcctgtttaatgaccctgatttgcgtgagcggctagcagctcaacagatacagctg
tcttcggccaattcgatgaatattggtcgtttgattcctcaggttgtctattatatttat
gcttatgcccagttggtaaggcatcagcgacttgaagctggagagacgattaacatagta
gtgccgacaggaaattttggcaatctactggctgcctactacgccaaagaaattggactt
cctgttgccaaattcatctgtgcttccaatgaaaacaatgtcttgacagatttctttgct
agtggtaggtatgataaaaagcgtcccttcaaggtgactactagtccatcaatggatatt
ttggtgtcttcaaatttagagcgcttggtttttcatttactaggcaatgatgcccaaaag
acagcagtattaatgaagagcttggcagaaacaggtcagtatcagctagctgatgcagat
cagtctatccttgatttatttgcggcaggctttgcaacagagcaagagactgctaaagag
atcaaaacgatatttgagtctgatcattatgtgcttgacccacatacagctgtagcttca
gctgtttatcgtgcttatcgggagcaatcaggtgactctagaccgactattgttgcgtca
actgctagtccttataagtttccgcgggtagttgtggaagctattagtggtcagcaggtt
gccagtgattttgaggcgcttgagcagttggctgatatatcaggtgtagtcgtgccacaa
gcggtcaatggcttacaggaggcgcccattcgtcatagccttttagtgacagtagcagat
atgcagcaggcagtagaggcttatcttggagtatag

DBGET integrated database retrieval system