KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0102Help
Entry
Sez_0102          CDS       T00746                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sez00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
107558..108409
Genome map
AA seq 283 aa AA seqDB search
MTAIIERAPAKINLGLDIQGKRPDGYHDLSMVLVSVDLCDYITVDHLEEDRILLTSNCPR
LPINEHNDVYKAAYLLKERFQISTGVSIFLDKRVPVCAGMGGGSSDAAAAIRALNQLWQL
KLSPRQMIDIGMQIGSDVPYCLFAGCAQVTGKGEVVKPINGRLSSWVVLVKPEFGISTRT
IFWDIDCETISRVPIEDLVSAIEAGDYQRLLATMGNSLEDISIAKRPFIQKVKDKMLQSG
ADIALMTGSGPTVFALCQTEKQANRVVNSLKGFCKEVYKVRTL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaatcattgagagagctcctgcaaaaataaatctaggcttagatattcaaggc
aagcgaccagatggctatcatgatctgtctatggttctagttagtgtagatctttgtgat
tatattacagtggatcatttagaggaggataggattttattgacctctaattgccctaga
ttgcctattaatgagcacaatgacgtttacaaggcggcttatttgctgaaagagcgattt
caaatctcaacaggtgtctctattttcttggataagagggtacctgtttgtgctggtatg
ggaggtggctcaagtgatgcggctgcagcaatcagagcattgaatcagctgtggcagcta
aagcttagtccccgtcagatgattgacattggcatgcagattggtagcgatgtgccttat
tgtctttttgcaggctgcgcccaagtgactggcaaaggcgaggtggttaagccaatcaat
ggccgcttgtcctcttgggtggttctagtgaagccagaatttggcatttctactagaacg
attttttgggatattgattgtgagacgatatctcgagtgccaattgaggatctggtttca
gccattgaggcaggtgattatcagcgcttgcttgcaacgatgggaaattccttagaggat
atttccattgctaaacggccgtttattcaaaaggttaaggataaaatgttgcagtcagga
gcagacattgccctgatgacaggaagtggtccaacagtatttgccctatgtcaaacagaa
aaacaggccaatcgtgtggtgaatagcctgaagggtttttgtaaggaggtctacaaggtt
agaacactgtag

DBGET integrated database retrieval system