KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0201Help
Entry
Sez_0201          CDS       T00746                                 

Gene name
hasC.1
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sez_0201 (hasC.1)
   00052 Galactose metabolism
    Sez_0201 (hasC.1)
   00500 Starch and sucrose metabolism
    Sez_0201 (hasC.1)
   00520 Amino sugar and nucleotide sugar metabolism
    Sez_0201 (hasC.1)
Enzymes [BR:sez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sez_0201 (hasC.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
221133..222035
Genome map
AA seq 300 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAPQG
KAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILEKQAPGAGNEVQLTDAIDK
LNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKDDLTDYIIKLSKQLNKDVKK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtcagaaaagccattatcccagccgccggcctaggcactcgcttcctgccc
gccaccaaggcactggccaaggaaatgctcccaatcgtcgataagccaaccattcaattc
atcgtcgaggaagccctaaaggcaggtatcgaggagattcttgtcgtcaccggcaaggcc
aaacgctctatcgaagaccactttgactccaacttcgagctcgaatacaatctccaagcc
aagggcaaaaccgagctactcaagctcgttgatgagaccactgccatcaacctgcacttc
attcgtcagagccaccctagaggactaggggacgctgtcctccaagccaaggcctttgtt
ggcaatgagccctttgtggtcatgctgggggatgacctcatggatattaccaatcctagt
gccaagcccttgaccaagcagcttattgaggattatgattgcacacacgcctcaacgatt
gcagtgatgagggtaccgcatgaggaggtttccaattatggtgtgattgcaccgcaaggg
aaggctgttaagggcttgtatagtgtggagacctttgttgagaagccaagtccagatgag
gcaccgagtgacttagcgattattggtcgatatttgttgacgcctgagatttttgccata
ttggagaagcaggcgcctggggctggcaatgaggtacagctgaccgatgcgattgacaag
ctcaataagacacagcgggtttttgcgagggagtttaagggagagcggtatgatgttggg
gacaagtttggctttatgaagacctcacttgactatgctctcaagcaccctcaggtcaag
gacgacctcactgactacattataaagctcagtaagcaactgaacaaggacgtcaagaaa
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system