KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0227Help
Entry
Sez_0227          CDS       T00746                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sez00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250356..251801
Genome map
AA seq 481 aa AA seqDB search
MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFVIRIEDTDRKRHVEDGERSQL
ENLRWLGIDWDESPETHERYRQSERLALYQQYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYVNEYLGMSADEKAAYIAEREAAGIVPTVRLAVNEAGIYKWTDMVKGDIVFEG
GNVGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPV
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEAEIFSR
EQLIALFDESRLSKSPAAFDQKKMDWMSNEYFKHADLGAVYALCKPFLEAAGRLTEKAEK
LVELYQPQLSSADEIVPLTDLFFSDFPELTAKEKEVMAAETVPTVLKAFKEKLEAMSDED
FKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGREQSIEHIANM
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaattcgtgtgcgctacgcaccaagcccaacaggtcttttacatatcgga
aatgcgcggacagcgctctttaactatctttatgctcgtcatcatggcggtgactttgtt
attcgtattgaggatactgatcgtaagcgccatgtcgaggacggtgagcgttctcagctg
gaaaatttgagatggcttggtatagattgggacgaaagccctgagacgcatgagcgttac
cgtcagtcagagcgtctagctctttatcaacagtacattgaccaattattagcagaaggc
aaggcctacaagtcttatgtgactgaggaggagttggcagcagagcgtgagcgtcaagag
gcagctggtgaaacacctcgctatgtcaatgaatatcttggcatgtcagcagatgaaaag
gcggcctatattgcagagcgtgaagcagcaggtattgtgcctacggttcgtttggctgtc
aatgaggctggtatttacaaatggacagacatggtaaaaggcgatatcgtatttgagggt
ggcaatgtcggtggtgactgggtaatccagaaaaaagacggctatccaacctacaatttt
gctgttgttattgatgatcacgatatgcaaatctcacacgttatccgcggagatgaccat
attgccaatacgccaaagcagttgatggtttacgaggcgcttggctgggaagcacccgtc
tttggtcatatgacccttatcattaattctgagacaggtaaaaagctatcaaagcgtgat
accaataccctgcagtttattgaggattaccgcaaaaaaggctatatgccagaggcagtc
tttaattttattgcccttttaggctggaatcctggcggggaggctgagatcttttctcgt
gagcaattgattgccttatttgatgagagtcgtcttagcaagtcgccagcagcctttgat
cagaaaaaaatggactggatgagcaatgagtactttaagcatgctgatcttggcgctgta
tatgcgctttgtaagccatttcttgaagcagcaggccgcttgactgaaaaagcagagaag
ctagttgagctctatcagcctcaattaagctctgctgatgagattgttccattgactgat
ttatttttctcagatttcccagagctgaccgcaaaagaaaaagaagtgatggcagctgag
actgttccaacagttctgaaggccttcaaggaaaagctagaggcgatgtcagatgaggac
tttaagccagaaaacattttcccacaaatcaaggctgtccaaaaagaaaccggcattaag
ggcaagaacctctttatgccaattcgtattgctgtttctggagaaatgcatggcccagag
ctgccaaataccatttacctccttggacgtgaacaatcgattgagcatattgccaatatg
ctttaa

DBGET integrated database retrieval system