KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0329Help
Entry
Sez_0329          CDS       T00746                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sez00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sez_0329 (recD)
Enzymes [BR:sez01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sez_0329 (recD)
DNA repair and recombination proteins [BR:sez03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sez_0329 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 AAA_22 AAA_16 UvrD-helicase Herpes_Helicase T2SSE DEAD UvrD_C AAA_12 Helicase_RecD AAA TsaE RsgA_GTPase AAA_14 AAA_18 AAA_28 5_3_exonuc Zeta_toxin NTPase_1 AAA_5 NACHT DUF2075 cobW AAA_33 AAA_29
Motif
Other DBs
NCBI-ProteinID: ACG61705
UniProt: B4U138
Position
complement(349184..351688)
Genome map
AA seq 834 aa AA seqDB search
MLSKHSASFREAAIVNVLEPAAVQVFDYLAQKGTVMEHFFTGTVDRIIFDNASNFFKILL
LAIEDTDSDFDEADIVITGTMAEIIEGEAYTFWGELTQHPRYGQQLRLSRYQKAKPSSAG
LVSYFSSEHFKGIGQKTAEKIIALYGNNPIDDILKNPSRLNEISSLSKANREAFVAKLKA
NYGTEQVIAALADLGLANRFAFQLFDKYKEEAVHIVKDNPYQLIEDIQGFGFKLADSLAE
QLGIESDSPKRFRAALLHCLLEQSIKRGDTYIQARELLALTISLLEDTRPVECDPAIVAN
QLTQLIDEGKVMTIGTRVFDSSLYYAEDGIQKHLTRLLQQPLTKEPSQDTIDQEIQAIQE
EFAITYDKIQKQAISQALTSKVFILTGGPGTGKTTVIRGILQAYASLYQIDLKQKDIPII
LAAPTGRAARRMNELTGLASATIHRHLGLNGDNDYQAMEDYLDCDLLIVDEFSMVDTWLA
NQLLTAINSNTQLIIVGDSDQLPSVGPGQVLADLLKVDRIPHITLDKIFRQSEESTIVDL
ANHIRQGILAPDFCQKKADRSYFEAQAPFIPGMMTKIVQAALKSGIPAEEIQILAPMYKG
LAGINSLNQLMQNLLNPLADQTEFLFNETAFRKGDKVLHLVNDAQLNVFNGDIGYITDLI
PAKYTESKQDEIVIDFDGTEIVYPRNEWLKITLAYAMSIHKSQGSEFQVVILPVTRQSGR
LLQRNLIYTAITRSKSKLIMLGEIAAFEEAIKKEGDKRHTYLVQRLQVAEADDHTAAASA
NESNESSLSVKPAPSPQKEQEQPPYLLTPHNFLAIDPMIGLTEDDMLTFFKKKS
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
gtgctatccaagcactcagctagctttagagaagcagctattgttaacgttctagaacct
gccgctgtgcaggttttcgactatcttgcacagaaaggtactgtcatggaacattttttt
acgggcactgttgaccggattatctttgacaatgcgtcaaattttttcaaaattctatta
ctggctatagaggatactgatagtgattttgatgaggctgacattgtcattacaggcact
atggctgagatcatagagggcgaggcctataccttttggggtgagctaacccagcaccca
aggtatggtcagcagctgcgcctaagccgctatcaaaaggctaagccctcctcagcaggt
cttgttagttatttttcgagtgagcatttcaagggcattggtcaaaaaacagctgaaaaa
atcattgccctttacggtaataaccctattgatgacattttaaaaaatcccagtcggctt
aatgagatctctagcctttctaaggctaatcgtgaagcctttgtggcaaagctcaaagcc
aattatggcactgagcaggtgattgctgccttggctgatctaggactggccaatcgcttt
gcctttcagctatttgacaaatacaaggaagaggctgttcatatcgtcaaggacaatcct
tatcaactcattgaggacattcaaggctttggctttaagctggctgatagcttagctgaa
cagctaggaatcgagagtgactctcccaagcgctttcgtgcggctctgctgcattgcctg
ttggagcaatccatcaagcgaggcgacacctatatccaggcacgtgagcttttggcgctg
accattagcctattagaggacacaaggccagtcgaatgcgacccagctattgttgccaat
cagctaacccagctcatcgacgagggcaaggttatgaccattggcacgcgtgtttttgac
agcagcctttattatgccgaagacggcattcaaaagcatctgacacgcttactacagcag
cctctgactaaggagcctagtcaagataccattgaccaagaaatccaagccatacaagag
gagtttgctataacctatgacaagatccaaaagcaggccatcagccaggcactgaccagc
aaggttttcattctaacaggaggcccaggcacaggaaagacaaccgttatcaggggcatt
ttacaggcctatgccagcctgtaccagattgacctgaaacaaaaggatattcccattatc
ctagcagctccaactggtcgagccgctcgtcgtatgaacgaattaaccggtctagcaagc
gcaactattcaccgccatcttgggttaaacggagacaatgattaccaggcaatggaggat
tatttagattgtgatttgctgattgttgatgagttttccatggttgatacctggctggcc
aatcagctattaacagccatcaattctaatacccagctgatcatcgtaggagatagcgac
cagctgccttctgtcggtcctggacaggtactagctgacttgctaaaggttgatcggatc
cctcacattacccttgacaagatttttcgccaatcagaggagtcaaccattgttgattta
gccaaccacatacgccaaggcattcttgctcctgatttttgtcagaaaaaggctgatcgc
tcctactttgaagcgcaagcgccattcattcccggtatgatgacaaagatcgtacaggct
gccctaaaaagtggcatcccagctgaggaaattcaaatcctagcccctatgtacaaagga
ctagcaggcatcaacagcctcaatcagctcatgcaaaacctcctgaatcctctagctgat
cagacagaatttctctttaacgagacggcctttcgtaagggagacaaggtgcttcacctt
gtcaatgacgcacagcttaatgtcttcaatggtgatattggctatatcacagacctcatt
ccagccaaatataccgaatccaagcaggacgaaatcgtcatagactttgatggcaccgag
atcgtctacccaagaaatgaatggttaaaaatcacccttgcctatgccatgagcattcac
aaatctcaaggcagtgaatttcaggtggtaatcctgcctgtcacccgtcagagtggtcga
cttctgcaaagaaacctcatctacactgccatcaccagatcaaaaagcaagctcatcatg
ctcggagaaatagccgcctttgaagaggcaatcaaaaaagaaggtgacaagcgacacacc
tatctcgtacaaaggcttcaagtggctgaagctgatgaccatacagcagctgcttcagca
aatgaatcaaatgagtctagcttatctgtaaagccagctcctagcccacaaaaggaacaa
gagcagcctccttatctgctcacccctcataatttcctagctatagatcccatgatcggt
ctaaccgaagatgatatgttaaccttttttaagaaaaaatcataa

DBGET integrated database retrieval system