KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0329Help
Entry
Sez_0329          CDS       T00746                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sez03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(349184..351688)
Genome map
AA seq 834 aa AA seqDB search
MLSKHSASFREAAIVNVLEPAAVQVFDYLAQKGTVMEHFFTGTVDRIIFDNASNFFKILL
LAIEDTDSDFDEADIVITGTMAEIIEGEAYTFWGELTQHPRYGQQLRLSRYQKAKPSSAG
LVSYFSSEHFKGIGQKTAEKIIALYGNNPIDDILKNPSRLNEISSLSKANREAFVAKLKA
NYGTEQVIAALADLGLANRFAFQLFDKYKEEAVHIVKDNPYQLIEDIQGFGFKLADSLAE
QLGIESDSPKRFRAALLHCLLEQSIKRGDTYIQARELLALTISLLEDTRPVECDPAIVAN
QLTQLIDEGKVMTIGTRVFDSSLYYAEDGIQKHLTRLLQQPLTKEPSQDTIDQEIQAIQE
EFAITYDKIQKQAISQALTSKVFILTGGPGTGKTTVIRGILQAYASLYQIDLKQKDIPII
LAAPTGRAARRMNELTGLASATIHRHLGLNGDNDYQAMEDYLDCDLLIVDEFSMVDTWLA
NQLLTAINSNTQLIIVGDSDQLPSVGPGQVLADLLKVDRIPHITLDKIFRQSEESTIVDL
ANHIRQGILAPDFCQKKADRSYFEAQAPFIPGMMTKIVQAALKSGIPAEEIQILAPMYKG
LAGINSLNQLMQNLLNPLADQTEFLFNETAFRKGDKVLHLVNDAQLNVFNGDIGYITDLI
PAKYTESKQDEIVIDFDGTEIVYPRNEWLKITLAYAMSIHKSQGSEFQVVILPVTRQSGR
LLQRNLIYTAITRSKSKLIMLGEIAAFEEAIKKEGDKRHTYLVQRLQVAEADDHTAAASA
NESNESSLSVKPAPSPQKEQEQPPYLLTPHNFLAIDPMIGLTEDDMLTFFKKKS
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
gtgctatccaagcactcagctagctttagagaagcagctattgttaacgttctagaacct
gccgctgtgcaggttttcgactatcttgcacagaaaggtactgtcatggaacattttttt
acgggcactgttgaccggattatctttgacaatgcgtcaaattttttcaaaattctatta
ctggctatagaggatactgatagtgattttgatgaggctgacattgtcattacaggcact
atggctgagatcatagagggcgaggcctataccttttggggtgagctaacccagcaccca
aggtatggtcagcagctgcgcctaagccgctatcaaaaggctaagccctcctcagcaggt
cttgttagttatttttcgagtgagcatttcaagggcattggtcaaaaaacagctgaaaaa
atcattgccctttacggtaataaccctattgatgacattttaaaaaatcccagtcggctt
aatgagatctctagcctttctaaggctaatcgtgaagcctttgtggcaaagctcaaagcc
aattatggcactgagcaggtgattgctgccttggctgatctaggactggccaatcgcttt
gcctttcagctatttgacaaatacaaggaagaggctgttcatatcgtcaaggacaatcct
tatcaactcattgaggacattcaaggctttggctttaagctggctgatagcttagctgaa
cagctaggaatcgagagtgactctcccaagcgctttcgtgcggctctgctgcattgcctg
ttggagcaatccatcaagcgaggcgacacctatatccaggcacgtgagcttttggcgctg
accattagcctattagaggacacaaggccagtcgaatgcgacccagctattgttgccaat
cagctaacccagctcatcgacgagggcaaggttatgaccattggcacgcgtgtttttgac
agcagcctttattatgccgaagacggcattcaaaagcatctgacacgcttactacagcag
cctctgactaaggagcctagtcaagataccattgaccaagaaatccaagccatacaagag
gagtttgctataacctatgacaagatccaaaagcaggccatcagccaggcactgaccagc
aaggttttcattctaacaggaggcccaggcacaggaaagacaaccgttatcaggggcatt
ttacaggcctatgccagcctgtaccagattgacctgaaacaaaaggatattcccattatc
ctagcagctccaactggtcgagccgctcgtcgtatgaacgaattaaccggtctagcaagc
gcaactattcaccgccatcttgggttaaacggagacaatgattaccaggcaatggaggat
tatttagattgtgatttgctgattgttgatgagttttccatggttgatacctggctggcc
aatcagctattaacagccatcaattctaatacccagctgatcatcgtaggagatagcgac
cagctgccttctgtcggtcctggacaggtactagctgacttgctaaaggttgatcggatc
cctcacattacccttgacaagatttttcgccaatcagaggagtcaaccattgttgattta
gccaaccacatacgccaaggcattcttgctcctgatttttgtcagaaaaaggctgatcgc
tcctactttgaagcgcaagcgccattcattcccggtatgatgacaaagatcgtacaggct
gccctaaaaagtggcatcccagctgaggaaattcaaatcctagcccctatgtacaaagga
ctagcaggcatcaacagcctcaatcagctcatgcaaaacctcctgaatcctctagctgat
cagacagaatttctctttaacgagacggcctttcgtaagggagacaaggtgcttcacctt
gtcaatgacgcacagcttaatgtcttcaatggtgatattggctatatcacagacctcatt
ccagccaaatataccgaatccaagcaggacgaaatcgtcatagactttgatggcaccgag
atcgtctacccaagaaatgaatggttaaaaatcacccttgcctatgccatgagcattcac
aaatctcaaggcagtgaatttcaggtggtaatcctgcctgtcacccgtcagagtggtcga
cttctgcaaagaaacctcatctacactgccatcaccagatcaaaaagcaagctcatcatg
ctcggagaaatagccgcctttgaagaggcaatcaaaaaagaaggtgacaagcgacacacc
tatctcgtacaaaggcttcaagtggctgaagctgatgaccatacagcagctgcttcagca
aatgaatcaaatgagtctagcttatctgtaaagccagctcctagcccacaaaaggaacaa
gagcagcctccttatctgctcacccctcataatttcctagctatagatcccatgatcggt
ctaaccgaagatgatatgttaaccttttttaagaaaaaatcataa

DBGET integrated database retrieval system