KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0469Help
Entry
Sez_0469          CDS       T00746                                 

Gene name
rbsK
Definition
ribokinase RbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sez_0469 (rbsK)
Enzymes [BR:sez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sez_0469 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
490201..491079
Genome map
AA seq 292 aa AA seqDB search
MDLVMETKRIAKEGETVFGEAFSMVPGGKGANQAVAVGRLSLDSDRITMLGAVGQDSFGP
LLLDNLKKNGVSVEYVGTVPLSSGIAQITIFNHDNRIIYCPGANGQVDTRTWQAEWEVLA
AADLVILQNEIPHEANLAIARYCHERGIKVLYNPAPARETDLDLLTFVDYVTPNEHECQD
LFPELSLEEALRTYPNKLIVTLGIRGAAYCDGKAIHVIPAIKAEAVDTTGAGDTFNGAFG
LAISHGLNTAAALRFATLASHLSVQQFGAQGGMPRLEEMKEHEAYEKAWDFK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaccttgtcatggaaactaagcggattgctaaggagggcgaaacggtctttggagaa
gccttttctatggttcctggtggtaaaggagccaatcaggctgtcgctgtaggacggctg
agcttagacagtgatagaattaccatgttaggagctgttgggcaggattcctttgggcca
ctcttgcttgacaacctcaaaaagaatggtgtttctgtggagtatgtgggaacggtacca
ttatctagtggaattgcccagattaccattttcaatcatgataatcgcattatttattgc
ccaggggctaatggtcaagtagataccaggacatggcaggcggagtgggaggtgctagcg
gcagcagacctggtgatcctgcaaaatgaaattccccatgaggctaatctggctattgct
cgttattgtcatgagcgtggcatcaaggtcctctacaatcctgcaccagctcgtgaaaca
gacttagacctgttgacttttgtggactacgttaccccaaatgagcatgaatgtcaggat
ctattcccagagctgagccttgaagaggctctaaggacctatcccaacaagctaatcgtg
acactcgggattaggggagctgcttattgtgatggtaaggctattcatgtgattccagct
atcaaggcagaggcggttgataccactggagcaggtgatacttttaatggtgcctttggt
cttgcgatctcacatgggctaaatacagcggcagccttacgctttgcgaccttggcttct
cacctatctgtccaacaatttggtgcccaagggggcatgccaaggctagaagaaatgaag
gagcatgaagcatatgaaaaagcatgggattttaaatag

DBGET integrated database retrieval system