KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0587Help
Entry
Sez_0587          CDS       T00746                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sez_0587 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_0587 (glcK)
   00052 Galactose metabolism
    Sez_0587 (glcK)
   00500 Starch and sucrose metabolism
    Sez_0587 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    Sez_0587 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sez_0587 (glcK)
   00524 Butirosin and neomycin biosynthesis
    Sez_0587 (glcK)
Enzymes [BR:sez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sez_0587 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612361..613332
Genome map
AA seq 323 aa AA seqDB search
MSQKLIGIDLGGTTIKFGILTSEGDVQEKWAIETNVLEDGKHIVPDIVASLKHRLDLYGL
TKDDFIGIGMGSPGAVNRTDHTVTGAFNLNWRGTQEVGSVIERELGIPFAIDNDANVAAL
GERWVGAGDNNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPLKGFACTCG
SQGCLETVASATGVVKVARLLAEAYEGDSSIKAAIDNGEAVSSKDIFVAAEAGDAFANSV
VEKVSYYLGLAAANISNILNPDSIVIGGGVSAAGEFLRSRVEKYFMTFTFPQVRQSTKIK
IAELGNDAGIIGAASLARQFITE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattgatagggattgatttgggcggaaccacgattaaatttggtatttta
acctcagagggtgacgttcaggaaaaatgggcgattgagacaaatgttttagaggacggt
aagcatattgttccagatattgtcgcctcactcaagcatcgccttgacctttatggactg
actaaggacgattttatcggtattggtatgggctcacctggagctgtcaatcgcacagat
catactgttacaggggcctttaacctcaactggagaggcacccaagaggtgggatctgtt
attgaaagggagctaggaattccctttgctattgataatgacgcaaatgttgcggccctc
ggcgagcgctgggtcggtgcaggtgacaataatcctgatgtggtctttatgaccttagga
acaggtgttggtggtggtatcatcgctgatgggaacttgattcatggtgtggctggagct
ggtggtgagattgggcacatgatagtagagccgcttaagggctttgcttgcacctgtggc
tcacagggctgcctggagacagtggcctctgctacaggtgttgttaaggttgctcgcctt
ttagcagaagcttacgaaggagattcaagcattaaggcagcgattgataatggagaggct
gtctcaagcaaggacatttttgttgcagcggaggctggtgatgcctttgccaactctgtt
gttgaaaaggtcagttattatctaggactggcagcggctaatatctcaaatattttgaac
cctgattcgatcgttattggcggtggtgtatctgctgcgggtgagtttttacgttcacgt
gttgaaaagtactttatgacttttacctttccgcaggttagacagtccactaaaatcaaa
atagcagagcttggtaatgatgctggtattattggtgcagctagccttgcaagacaattt
atcacagaatag

DBGET integrated database retrieval system