KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0635Help
Entry
Sez_0635          CDS       T00746                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sez_0635 (gpmA)
   01230 Biosynthesis of amino acids
    Sez_0635 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_0635 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Sez_0635 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sez_0635 (gpmA)
Enzymes [BR:sez01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sez_0635 (gpmA)
Exosome [BR:sez04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sez_0635 (gpmA)
  Exosomal proteins of melanoma cells
   Sez_0635 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
655424..656119
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIAFDLAFTSVLKR
AIKTTNLALEYSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPDMAKDDEHSAHTDRRYAHLDHSVIPDAENLKVTLERALPFWEDKIAPALVDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMNVEIPNFPPLVFEFDDKLNLTAEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgtcatggtgagtcagaatggaacaaagcaaaccttttc
actggttgggctgacgttgatttgtccgaaaagggaacacagcaggctattgatgctgga
aaattgatcaaggaagctggtattgcatttgatcttgcctttacatctgtgcttaagcgt
gctatcaagacaactaatcttgcacttgagtattctgatcagctttgggtacctgttgaa
aaatcatggcgcttgaacgagcgtcactatggcggcttgactggtaaaaacaaggcagaa
gcagctgagcaatttggtgatgagcaggttcatatctggcgccgttcatatgatgtgttg
cctcctgatatggctaaggatgatgagcattcagcacatactgatcgtcgttacgctcat
cttgatcattctgttattccagatgcagaaaacctgaaggtgacactagagcgtgctctt
cctttctgggaggataagattgcaccagccttagttgatggtaaaaatgtttttgttgga
gcacatggtaactctattcgtgcccttgtcaaacacatcaagcaattatcagatgatgag
attatgaatgtggaaatcccgaacttcccaccacttgtgtttgaatttgatgacaagcta
aaccttactgctgagtactacctcggcggtgaataa

DBGET integrated database retrieval system