KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0641Help
Entry
Sez_0641          CDS       T00746                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sez03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660769..661365
Genome map
AA seq 198 aa AA seqDB search
MLYPIPIAKLIESYSKLPGIGVKTATRLAFYTIGMSDEDVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCHICTDSSRDKETILVVEASKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMAGEATEVIVATNATADGEATAMYISRILKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgctttaccctataccaatcgcaaaattaattgaaagctattctaaattaccagggatt
ggtgttaaaacagcgacaagattggctttttacaccattggaatgtctgatgaggatgtg
aatgattttgccaaaaatttattagcagctaagcgagaattaacctattgctccatctgt
ggcaatttgacagatgatgatccctgccatatttgcacagatagcagtcgggataaagag
actattttagttgttgaggcttccaaggacgtttctgctatggaaaaaattcaagaatat
catggctattaccatgtgctgcatggcttgatttctcccatgaatggggttggtccagat
gacatcaatctaaagagcctaatcacgcgtttgatggctggagaggcaacggaggtcatt
gttgcaacgaatgccacagcagatggagaggcgactgcgatgtacatttcacgtatccta
aagcctgctggtatcaaggtaacgagattggctagaggcttggcagtaggatcagacatt
gaatatgctgatgaagtgaccctgctgcgagcgattgaaaatcgaacagaattatag

DBGET integrated database retrieval system