KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0682Help
Entry
Sez_0682          CDS       T00746                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sez_0682 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sez_0682 (murA)
Enzymes [BR:sez01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Sez_0682 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707165..708424
Genome map
AA seq 419 aa AA seqDB search
MRKIIINGGKALSGEVAVSGAKNSVVALIPAIILADGVVTLDGVPAISDVDSLIEIMKLM
GAMVTYQGDTLEIDPRGVQNIPMPYGKINSLRASYYFYGSLLGRFGQAVVGLPGGCDLGP
RPIDLHLKAFEAMGAQISYEGASMHLMTEAQQLHGAHIYMDTVSVGATINTMIAATKAKG
KTIIENAAREPEIIDVATLLNNMGAHIRGAGTDVITIEGVERLHGTRHQVIPDRIEAGTY
IALAAAIGSGVRITNVLYEHLESFIAKLEEMGVRMTVEEDSIFVEKQEALKAVTIKTSPY
PGFATDLQQPLTPLLLRAEGRGSIIDTIYEKRVNHVPELARMGADIAILGSQIVYHGSNQ
LSGAQVKATDLRAGAALVIAGLMAQGKTEISNIEFILRGYANIIDKLTALGADIQLIEA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaattattattaatggtggaaaagccttatccggagaggtggcagtttcaggt
gctaaaaatagcgttgtagcgcttattcctgcgattattttggcagatggtgttgtcact
ttagatggggtaccagctattagtgatgttgacagccttatcgaaatcatgaagctcatg
ggagctatggtgacctatcagggggataccttggagattgaccccagaggggttcaaaat
attcctatgccttatggtaaaattaacagcctaagagcctcttactatttttatggtagt
ctattgggacgctttgggcaggcggttgtgggcttgccgggtggctgtgacttgggccct
aggcctattgatctccacctgaaggcttttgaagcaatgggggcccagatatcttatgag
ggagcaagcatgcacctgatgacagaggctcagcagcttcatggcgctcatatctacatg
gatactgtcagtgtaggcgctaccattaataccatgattgctgcaacaaaggcaaagggt
aagaccattattgaaaatgcagctagagagcctgagattattgacgttgcgacactgtta
aataacatgggggcgcatattcgtggtgcaggtactgatgtgattacgattgagggagtt
gaaaggcttcatggtaccaggcatcaggtgatcccagatcgtattgaggccggtacctat
attgccttagcggccgctattggtagtggggtaaggattaccaatgtcctttacgagcac
ttagagagctttattgctaagctggaggaaatgggtgtgagaatgacggttgaagaggat
tctatttttgtggaaaagcaggaagccttgaaagcagtcactattaaaacctctccctat
ccaggctttgccactgacctacagcagcctttgactcctctgcttttaagggctgagggt
cgtggtagtatcattgatacgatatatgaaaagcgtgtcaatcatgtgccagagcttgct
cgtatgggagcagatattgccattcttggcagccaaattgtttatcatggctctaatcag
ctcagtggggcacaggttaaggcaactgatttgcgggctggtgctgctttggtgattgca
ggcctaatggctcagggtaaaaccgagattagcaatattgagtttattttacgtggctac
gctaacattattgataagctaacagccttaggggctgacattcagcttattgaggcttaa

DBGET integrated database retrieval system