KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0712Help
Entry
Sez_0712          CDS       T00746                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sez00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sez00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(737829..738332)
Genome map
AA seq 167 aa AA seqDB search
MTSIYDFSVKRQDGTDCSLEQYQGKVLLVVNTATKCGLTPQYQALQELYDTYREQGFEIL
DFPCNQFLHQAPGDATEINAFCSLTYHTTFPRFAKIKVNGKETEPLFTWLKEQKSGPLGK
RIEWNFAKFLIDQKGQVVERYASKTDPKMIETALQRLLFQEPIDQSD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgactagcatttatgactttagcgttaaaagacaagatggcactgattgttcactggag
caataccaaggaaaggtcctattagtggtcaacaccgccactaaatgcggattaactcct
caatatcaagcattacaagagctttatgacacctacagggaacaaggctttgaaatcctt
gatttcccctgcaatcaattcttacatcaagcaccgggtgatgctacagaaatcaatgcc
ttttgcagcttaacttaccacaccacctttccacgctttgccaaaattaaggttaatggc
aaggagacagagccattattcacttggctcaaggaacaaaaaagtggcccacttggcaag
cgcatcgaatggaatttcgcaaaatttttaattgatcaaaaggggcaggttgttgagcgc
tatgcctcaaaaacagacccgaaaatgattgaaacagccctacagcgattgctcttccaa
gagccaattgaccaatcagactaa

DBGET integrated database retrieval system