KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0741Help
Entry
Sez_0741          CDS       T00746                                 

Gene name
bga
Definition
beta-galactosidase precursor Bga
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sez_0741 (bga)
Enzymes [BR:sez01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sez_0741 (bga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
773887..775671
Genome map
AA seq 594 aa AA seqDB search
MKQFCVKEQFYLDGKPFKILSGAIHYFRIAPDSWPRVLYQLKALGFNTVETYIPWNMHEP
RKGQFTFEGIADVEAFLDLAQEYGLYAIVRPSPYICAEWEFGGLPAWLLTENCRVRSSDE
VFLKHVSDYYDVLLPKLVKRQLDNGGNILMFQLENEYGSYGEEKDYLRKLKELMLAKGIS
APLFTSDGPWLATLASGSLIDDDVFVTGNFGSNASKQFASMQDFFQAHQKQWPLMCMEFW
LGWFNRWNEPIIRRDPKEAVDAIMEAIELGSINLYMFCGGTNFGFMNGSSARLQKDLPQI
TSYDYDALLDEAGNPTKKYILLQERLKERYPQLSFAEPMTSPTMALESIKLSARVSLFKT
IKNVSALKKSFYPCNMEELDQPTGYLLYRTHLARHSKEERLRVIDARDRIQLFLDEKHVK
TQYQEEIGQDILIHQEDETTQLDLLVENMGRVSYGHKLTAPSQQKGLGRGLMADLHFVGH
WEHFLLDFQELDWIDFSAGWTDGVPGFYAYDFDCQQPADTYLDLSQFGKGIALVNGVNLG
RFWKVGPTLSLYIPKGLLKQGQNRLLIFETEGQFSESIRLTKEPIYNDIKGENL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagttttgcgtaaaggagcagttttaccttgatggcaagccgtttaagatatta
tcaggtgccattcattactttagaatagctcctgatagctggcctagggtgctttatcag
ctgaaagccttaggctttaatacagtagaaacctatattccttggaacatgcatgagcca
aggaagggacagtttacctttgaggggattgcagatgttgaggcgtttttggatttggca
caggaatatggtctatatgctattgtcagaccttcaccttatatctgtgctgaatgggaa
tttggtggtttgcctgcttggctattaactgaaaattgtcgtgtcagatcaagcgatgag
gtctttcttaagcatgtatcagattattatgatgtgttactaccaaagctggtgaagcgt
cagttagataatggcggcaatattctgatgtttcagcttgaaaatgagtatggttcttat
ggtgaagaaaaggattatttaagaaaattaaaagagcttatgcttgctaaaggcattagt
gcccctcttttcacctcagatggaccttggttagccacgctagcatcaggaagtttgatt
gatgatgatgtttttgtgacaggcaactttgggtcaaacgcttcaaaacaatttgccagc
atgcaggattttttccaagcacatcaaaagcaatggcctctgatgtgtatggaattctgg
ttgggctggtttaatcgctggaatgagccaatcattcgaagggaccccaaggaagctgtt
gatgcaatcatggaagctatagagctaggcagcattaacctttatatgttttgtggtggc
actaattttggctttatgaatggctcgtcagctcgtctgcaaaaggatttaccacagata
acctcctatgattacgacgcattactagatgaggcaggaaacccaacgaagaaatatatc
ctgctacaagaacgtctcaaggagcgttacccccaattatcctttgcagagccaatgacc
agtcctacgatggccttagagtctatcaagttgtcggcaagggttagtctttttaagaca
atcaaaaatgtaagcgctcttaagaagagcttttatccctgcaatatggaggagctagat
caaccaacgggctacctactgtatagaacgcacctcgctagacatagcaaggaggagcgg
ctcagggtcattgatgctagagaccgcattcagctctttttagatgaaaagcacgtgaaa
acccagtatcaggaggaaatcggtcaggatatactgatacaccaagaagacgagaccaca
cagcttgatcttttagttgaaaatatgggacgtgtcagctatgggcataagctaacagca
ccaagtcaacaaaaaggattaggcagaggcttaatggctgacttgcattttgtaggtcat
tgggagcattttctgctagattttcaagagctggattggattgatttttctgcaggctgg
actgatggggtgccaggattttacgcctatgattttgattgtcagcagccggcagatacc
tatcttgatttgagtcaattcggaaaaggaattgcccttgtaaatggtgttaacctagga
cgtttttggaaggtcggtccaacattatcgctttatattcctaagggattattaaagcaa
ggtcaaaatagactgctgatatttgaaaccgaagggcagtttagtgagtcaattcgttta
actaaggaaccaatttataatgatataaaaggagaaaacttatga

DBGET integrated database retrieval system