KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0801Help
Entry
Sez_0801          CDS       T00746                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sez00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sez00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833695..834978
Genome map
AA seq 427 aa AA seqDB search
MEKLVDKIIIEGGSTRLEGEVTIEGAKNAVLPLLAATILPSTGKTVLRNVPILSDVFTMN
HVVRGLNIDVDFDEAANQITVDASGDILDVAPYEYVSQMRASIVVLGPILARNGHAKVSM
PGGCTIGSRPIDLHLKGLEAMGAEITQQGGDITAKADRLKGAMIYMDFPSVGATQNLMMA
ATLADGVTVIENAAREPEIVDLAQLLNKMGAKVRGAGTETLTITGVTSLCGVEHDVVQDR
IEAGTFMIAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVVEEDAGIRVQADVTKLKPV
TVKTLPHPGFPTDMQAQFTALMAIVKGESTMVETVFENRFQHLEEMRRMGLQSEVLRDTA
MIHGGHELQGAPVMSTDLRASAALILTGMVAKGRTTVNKLNHLDRGYYQFHEKLAKLGAN
IQRISEE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcttgtggataaaataatcatagaaggtgggagcacacgtttagagggagag
gtaacgatcgaaggcgctaaaaatgccgttcttcctttactagcagctactatcctcccc
tcaactggaaagactgtcttgagaaatgtgccgattctctcagatgtttttacgatgaac
catgttgtgcgtggcctaaatattgacgtcgactttgatgaggctgccaaccagattaca
gttgatgcctcaggggacattttagatgttgccccgtacgagtatgtcagccaaatgcgc
gcctcaattgtggttttaggcccgattttagctcgtaatggccatgccaaggtatcgatg
cctggaggctgtacgattggcagtaggccgattgatttgcatttaaagggtctagaggct
atgggcgctgagatcacccagcagggtggtgacatcactgcaaaggcagatcgcctaaag
ggggcgatgatctatatggacttcccatcagtgggggctacgcaaaatttgatgatggca
gcgacccttgctgatggtgtgacagtcattgaaaatgctgcccgcgagcctgagattgtt
gacctagcccagctgctcaacaaaatgggggctaaggttcgtggggcaggtaccgaaacc
ctgaccataacgggtgtcaccagtctatgtggtgttgagcatgatgttgttcaggatcgt
atcgaagcaggtacctttatgattgctgcagcaatgacctctggtaatgtgctgattaga
gatgctgtatgggagcataatcggcccttgatttctaagctcatggaaatgggagtgtct
gttgtcgaagaggacgcaggcattagggtgcaggctgatgtgactaagctaaagcctgtc
actgttaaaacccttcctcacccaggctttccaacagatatgcaggctcagtttacagcc
cttatggccattgttaagggagaatctacaatggtggaaacagtctttgaaaatcgtttc
cagcacttagaagaaatgcgacgcatgggcttacaatctgaggtattgcgtgatacagcc
atgattcatggtggtcatgaattgcagggggcgcctgtgatgtcaacagacctgcgagct
agtgcagccctcatcttaacgggaatggttgccaagggcaggaccactgttaataagttg
aaccatttagatcgtggctattatcagtttcatgaaaagcttgccaagctaggtgccaac
attcagcgaattagtgaggagtag

DBGET integrated database retrieval system